| Clone Name | bastl07b09 |
|---|---|
| Clone Library Name | barley_pub |
>MGAT1_CAEEL (Q11068) Putative alpha-1,3-mannosyl-glycoprotein| 2-beta-N-acetylglucosaminyltransferase (EC 2.4.1.101) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I) (GNT-I) (GlcNAc-T I) Length = 449 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +2 Query: 164 GGGWYCGSHLPTW------WGVHFWSQWESDLQRRRSARC*R 271 G GW S TW W V FW W D RR+ +C R Sbjct: 256 GLGWMMSSK--TWHELEPIWPVGFWDDWMRDPARRKDRQCIR 295
>TOM1_NEUCR (Q9P4Z1) E3 ubiquitin protein ligase TOM1-like protein (EC 6.3.2.-)| Length = 4065 Score = 28.1 bits (61), Expect = 5.7 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 17/66 (25%) Frame = -2 Query: 326 MEHFGHLILEAVKGHLPRDVNSV-----------------RFSSFVNQIPIGTRSELPTM 198 +EH G+ + A H+ R +NS R+++ V ++P RS PT+ Sbjct: 135 LEHCGNRSIYASSHHIDRLLNSPYLEVQAAALEVGLELAQRYNASVKRMPSPPRSVNPTL 194 Query: 197 LANGYH 180 LAN Y+ Sbjct: 195 LANHYN 200
>AROE_STRP8 (Q8P031) Shikimate dehydrogenase (EC 1.1.1.25)| Length = 292 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 159 SMAEGGIVVAICQHGGEFTSGPNGNLIYKGGEAHAVDVSREMSLDSFK 302 S AE ++ QHG + G ++Y+G EA + ++M +D+ K Sbjct: 239 SPAETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQDMPVDAIK 286
>AROE_STRP6 (Q5XAV7) Shikimate dehydrogenase (EC 1.1.1.25)| Length = 292 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 159 SMAEGGIVVAICQHGGEFTSGPNGNLIYKGGEAHAVDVSREMSLDSFK 302 S AE ++ QHG + G ++Y+G EA + ++M +D+ K Sbjct: 239 SPAETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQDMPVDAIK 286
>AROE_STRP3 (P63598) Shikimate dehydrogenase (EC 1.1.1.25)| Length = 292 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 159 SMAEGGIVVAICQHGGEFTSGPNGNLIYKGGEAHAVDVSREMSLDSFK 302 S AE ++ QHG + G ++Y+G EA + ++M +D+ K Sbjct: 239 SPAETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQDMPVDAIK 286
>AROE_STRP1 (P63597) Shikimate dehydrogenase (EC 1.1.1.25)| Length = 292 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 159 SMAEGGIVVAICQHGGEFTSGPNGNLIYKGGEAHAVDVSREMSLDSFK 302 S AE ++ QHG + G ++Y+G EA + ++M +D+ K Sbjct: 239 SPAETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQDMPVDAIK 286
>RPOM_METJA (Q58548) DNA-directed RNA polymerase subunit M (EC 2.7.7.6)| Length = 108 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 244 KEEKRTLLTSLGRCPLTASRMRCPKC 321 K+EK T++ S G L +R+ CPKC Sbjct: 47 KKEKITVIESEGLETLPTTRIECPKC 72
>RSMN_RAT (P63164) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) Length = 240 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 253 SPPL*IRFPLGPEVNSPPCWQMATTIPPSAMLP 155 +PP +R P+GP + PP +PP M P Sbjct: 190 APPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP 222
>RSMN_MOUSE (P63163) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 253 SPPL*IRFPLGPEVNSPPCWQMATTIPPSAMLP 155 +PP +R P+GP + PP +PP M P Sbjct: 190 APPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP 222
>RSMN_HUMAN (P63162) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 253 SPPL*IRFPLGPEVNSPPCWQMATTIPPSAMLP 155 +PP +R P+GP + PP +PP M P Sbjct: 190 APPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP 222
>MTMR9_MOUSE (Q9Z2D0) Myotubularin-related protein 9| Length = 545 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 140 IAEQLRKHGGGWYCGSHLPTWWGVH 214 +A+Q R GGG+ +H P W +H Sbjct: 241 VAQQARAKGGGFEQEAHYPQWRRIH 265
>MTMR9_HUMAN (Q96QG7) Myotubularin-related protein 9| Length = 549 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 140 IAEQLRKHGGGWYCGSHLPTWWGVH 214 +A+Q R GGG+ +H P W +H Sbjct: 241 VAQQTRAKGGGFEQEAHYPQWRRIH 265
>RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein| Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) Length = 3224 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 321 TLWTPHP*SCQGTSPERRQQRALLLLCKSDSHWD 220 T++TP TSPE Q R L+ K + HWD Sbjct: 1393 TVFTPK------TSPENVQDRFALVTPKKEGHWD 1420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,905,180 Number of Sequences: 219361 Number of extensions: 664184 Number of successful extensions: 2584 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2583 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)