| Clone Name | bastl07a04 |
|---|---|
| Clone Library Name | barley_pub |
>PARP4_HUMAN (Q9UKK3) Poly [ADP-ribose] polymerase 4 (EC 2.4.2.30) (PARP-4) (Vault| poly(ADP-ribose) polymerase) (VPARP) (193-kDa vault protein) (PARP-related/IalphaI-related H5/proline-rich) (PH5P) Length = 1724 Score = 30.8 bits (68), Expect = 0.81 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Frame = -1 Query: 344 PIITPAVGSFLLPV----RPGSMVGRSWRGC*VFGRR--QNQIDGSMMVRMPNPG 198 PI+ PAVGS+L P P S+ S+R FG Q D S + P PG Sbjct: 1317 PILAPAVGSYLTPTTRAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPG 1371
>ITB4_HUMAN (P16144) Integrin beta-4 precursor (GP150) (CD104 antigen)| Length = 1822 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 82 FFACLLACCMLVPCCGRG 29 + AC AC L+PCC RG Sbjct: 735 YCACCKACLALLPCCNRG 752
>HIPK2_MOUSE (Q9QZR5) Homeodomain-interacting protein kinase 2 (EC 2.7.11.1)| (Nuclear body-associated kinase 1) (Sialophorin tail-associated nuclear serine/threonine-protein kinase) Length = 1196 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -1 Query: 353 HSVPIITPAVGSFLLPVRPGSMVGRSWRG 267 ++VPI+T A G+ L ++PG + ++W G Sbjct: 681 NAVPIVTQAPGAQPLQIQPGLLAQQAWPG 709
>MAGE1_MACFA (Q9BE18) Melanoma-associated antigen E1 (MAGE-E1 antigen)| Length = 957 Score = 28.5 bits (62), Expect = 4.0 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 4/79 (5%) Frame = +1 Query: 175 PGVSFPFLPGFGILTIIDPSIWFWRRPKT*QPLHERPTIEPGLTGSKNEPTAGVMMGTEC 354 P S P PG G T + P+ + +I T K T+G TE Sbjct: 244 PSTSMPATPGEGRSTTMLPAA------------SDGQSISLVPTPGKGSSTSGPPTATEG 291 Query: 355 ITTSL----GEDPEPSVPP 399 ++TS+ GE P SVPP Sbjct: 292 LSTSVQPTAGEGPSTSVPP 310
>EUTB_ECOLI (P0AEJ6) Ethanolamine ammonia-lyase heavy chain (EC 4.3.1.7)| (Ethanolamine ammonia-lyase large subunit) Length = 453 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 294 FNGRSFMERLLGFRPAPEPDRWIDDGEDAESGE--EREGNP 178 F+ + + +LL RP+PE +RW++ +G +R G+P Sbjct: 409 FHDTATVRQLLNLRPSPEFERWLESMGIMANGRLTKRAGDP 449
>EUTB_ECO57 (P0AEJ7) Ethanolamine ammonia-lyase heavy chain (EC 4.3.1.7)| (Ethanolamine ammonia-lyase large subunit) Length = 453 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 294 FNGRSFMERLLGFRPAPEPDRWIDDGEDAESGE--EREGNP 178 F+ + + +LL RP+PE +RW++ +G +R G+P Sbjct: 409 FHDTATVRQLLNLRPSPEFERWLESMGIMANGRLTKRAGDP 449
>STP10_ARATH (Q9LT15) Sugar transport protein 10 (Hexose transporter 10)| Length = 514 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 350 SVPIITPAVGSFLLPVRPGSMVGR 279 +VP + +GSF+LP P SM+ R Sbjct: 210 AVPAVVMVIGSFILPDTPNSMLER 233
>YWIE_CAEEL (Q23525) Hypothetical protein ZK546.14 in chromosome II| Length = 472 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 225 DDGEDAESGEEREGN 181 DD ED+E GEE EGN Sbjct: 163 DDDEDSEDGEEPEGN 177
>EUTB_SALTY (P19264) Ethanolamine ammonia-lyase heavy chain (EC 4.3.1.7)| (Ethanolamine ammonia-lyase large subunit) Length = 453 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 294 FNGRSFMERLLGFRPAPEPDRWIDDGEDAESGE--EREGNP 178 F+ + + +LL RP+PE +RW++ +G +R G+P Sbjct: 409 FHDTATVRQLLNLRPSPEFERWLETMGIMANGRLTKRAGDP 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,531,937 Number of Sequences: 219361 Number of extensions: 954332 Number of successful extensions: 2858 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2856 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)