| Clone Name | bastl06g04 |
|---|---|
| Clone Library Name | barley_pub |
>CO4A1_CAEEL (P17139) Collagen alpha-1(IV) chain precursor| Length = 1759 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 349 GILGEEAADGLVGVHGALAQRGVDLGFRAVD 257 G GE ADGL G+ GA RG+ R V+ Sbjct: 697 GYKGERGADGLPGLPGAQGPRGIPAPLRIVN 727
>BBC1_YEAST (P47068) Myosin tail region-interacting protein MTI1 (BBC1 protein)| Length = 1157 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 273 PRSTPRCASAPWTPTRPSAASSPKIP 350 P P SAP P+ PS S+P +P Sbjct: 691 PHPVPSAPSAPPVPSAPSVPSAPPVP 716
>NAPA_HELHP (Q7VJT5) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 937 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 275 EIYAALRE--CAMDPDEAVSRLLSQDTFQEVKSKRDKKK 385 E+Y A+ E C M PD+A ++ L Q+ V+S+R K K Sbjct: 845 ELYRAVPEALCYMHPDDANAQNLEQNQVVWVESRRGKVK 883
>HXA4_HUMAN (Q00056) Homeobox protein Hox-A4 (Hox-1D) (Hox-1.4)| Length = 320 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +3 Query: 270 KPRSTP-----RCASAPWTPTRPSAASSPKIP 350 +PR+ P RC +AP TP P+ S+P P Sbjct: 145 QPRAVPPAAPRRCEAAPATPGVPAGGSAPACP 176
>104K_THEAN (Q4U9M9) 104 kDa microneme-rhoptry antigen precursor (p104)| Length = 893 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 282 TPRCASAPWTPTRPSAASSPKIPF 353 +PR +P +P P + SPK+PF Sbjct: 640 SPRRPESPKSPKSPKSPKSPKVPF 663 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,833,621 Number of Sequences: 219361 Number of extensions: 284801 Number of successful extensions: 1650 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1633 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)