Clone Name | bastl06f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KLK12_HUMAN (Q9UKR0) Kallikrein-12 precursor (EC 3.4.21.-) (Kall... | 32 | 0.57 | 2 | FA12_HUMAN (P00748) Coagulation factor XII precursor (EC 3.4.21.... | 28 | 6.3 | 3 | GCH2_PICGU (P50139) GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cycl... | 28 | 8.3 |
---|
>KLK12_HUMAN (Q9UKR0) Kallikrein-12 precursor (EC 3.4.21.-) (Kallikrein-like| protein 5) (KLK-L5) Length = 248 Score = 31.6 bits (70), Expect = 0.57 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +3 Query: 9 RLRLPLLVSSPVRPIPLPN 65 RLRLP+ V+S V+P+PLPN Sbjct: 113 RLRLPVRVTSSVQPLPLPN 131
>FA12_HUMAN (P00748) Coagulation factor XII precursor (EC 3.4.21.38) (Hageman| factor) (HAF) [Contains: Coagulation factor XIIa heavy chain; Beta-factor XIIa part 1; Beta-factor XIIa part 2; Coagulation factor XIIa light chain] Length = 615 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 9 RLRLPLLVSSPVRPIPLPNQTSRSPPQ 89 RL +PL+ + P P P P T+R+PPQ Sbjct: 310 RLHVPLMPAQPAPPKPQP--TTRTPPQ 334
>GCH2_PICGU (P50139) GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II)| Length = 344 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 3 THRLRLPLLVSSPVRPIPLPNQTSRSPPQV 92 TH +PLL S + P +P+QT + PP+V Sbjct: 19 THEFTMPLL-SPTLTPSHIPSQTPQIPPEV 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,406,169 Number of Sequences: 219361 Number of extensions: 144290 Number of successful extensions: 768 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)