| Clone Name | bastl06e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 40 | 0.002 | 2 | PO121_MOUSE (Q8K3Z9) Nuclear envelope pore membrane protein POM ... | 29 | 2.8 | 3 | SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (S... | 28 | 4.8 | 4 | NIFU_AZOBR (Q43909) Nitrogen fixation protein nifU | 28 | 6.3 | 5 | TBX21_MOUSE (Q9JKD8) T-box transcription factor TBX21 (T-box pro... | 28 | 6.3 |
|---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 40.0 bits (92), Expect = 0.002 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = +1 Query: 133 MLTATKPLXXXXXXXXXXXXXXXTFVVPEARRKPG 237 MLTATKPL TFVVPEARRKPG Sbjct: 1 MLTATKPLVGGACAAPSSSARRRTFVVPEARRKPG 35
>PO121_MOUSE (Q8K3Z9) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) Length = 1200 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 232 VSGEPRAPRTSSAGPTTTARHTRPRLAAWSPSA 134 +S EPR PR S+ RH RP L A P A Sbjct: 71 LSREPRGPRALSSFVRDARRHPRPALTASPPPA 103
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 28.5 bits (62), Expect = 4.8 Identities = 22/66 (33%), Positives = 26/66 (39%) Frame = -2 Query: 217 RAPRTSSAGPTTTARHTRPRLAAWSPSASWVRYGVGYCATRWGGRLHRLGWFRPS*TVQP 38 R+ S G + RH R R +WS S S R Y +R GR H G R Sbjct: 378 RSSSRSRRGYYRSGRHARSRSRSWSRSRSRSR---RYSRSRSRGRRHSDGGSRDGHRYSR 434 Query: 37 CPGRSG 20 P R G Sbjct: 435 SPARRG 440
>NIFU_AZOBR (Q43909) Nitrogen fixation protein nifU| Length = 310 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 208 RTSSAGPTTTARHTRPRLAAWSPSASWVR 122 +T + GP T P + W+PS+ W R Sbjct: 191 KTGAVGPAQAPSPTPPARSGWTPSSRWPR 219
>TBX21_MOUSE (Q9JKD8) T-box transcription factor TBX21 (T-box protein 21)| (Transcription factor TBLYM) (T-cell-specific T-box transcription factor T-bet) Length = 530 Score = 28.1 bits (61), Expect = 6.3 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = -2 Query: 202 SSAGPTTTARHTRPRLAAWSPSASWVRYGVGYCATRWGGRLHRLGWFRPS*TVQPCPGRS 23 S+ GPT + LA P A W A ++ ++ GWFRP T+ PG Sbjct: 410 SAPGPTVPYYRGQDVLA---PGAGWP------VAPQYPPKMSPAGWFRPMRTLPMDPGLG 460 Query: 22 GKEE 11 EE Sbjct: 461 SSEE 464 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,263,407 Number of Sequences: 219361 Number of extensions: 538141 Number of successful extensions: 1425 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1425 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)