Clone Name | bastl06d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OC17_CHICK (Q9PRS8) Ovocleidin-17 (OC-17) | 30 | 2.5 | 2 | TRUA_PHOPR (Q6LNU5) tRNA pseudouridine synthase A (EC 5.4.99.12)... | 28 | 9.7 | 3 | EVPL_MOUSE (Q9D952) Envoplakin (p210) (210 kDa cornified envelop... | 28 | 9.7 | 4 | TRUA_VIBVY (Q7M7J4) tRNA pseudouridine synthase A (EC 5.4.99.12)... | 28 | 9.7 | 5 | TRUA_VIBVU (Q8CWK3) tRNA pseudouridine synthase A (EC 5.4.99.12)... | 28 | 9.7 |
---|
>OC17_CHICK (Q9PRS8) Ovocleidin-17 (OC-17)| Length = 142 Score = 30.0 bits (66), Expect = 2.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 227 GERGREWSSWLVSRAPLWLAGERARADGRCCRLSDSE*PYGW 102 G R WS R W +AR GRC L D E W Sbjct: 84 GSRSWRWSDGTAPRFASWHRTAKARRGGRCAALRDEEAFTSW 125
>TRUA_PHOPR (Q6LNU5) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 261 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -2 Query: 269 LLRLVGSGVKRALMGERGREWSSWLVSRAPLWLAGERARADG 144 ++R + + R G+ EW W++ + +AGE A+A G Sbjct: 194 MVRNIAGSLIRVGRGQETPEWMKWVLEQKDRRVAGETAKAAG 235
>EVPL_MOUSE (Q9D952) Envoplakin (p210) (210 kDa cornified envelope precursor| protein) Length = 2035 Score = 28.1 bits (61), Expect = 9.7 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -2 Query: 176 WLAGERARADGRCCRLSDSE*PYGW--GGGVAGLASTPSMLLLLGVP-LEAVARSSR 15 W +GE G C L D+ PY W G S P+ L + P EAV ++SR Sbjct: 424 WDSGEVQLLRGERCTLKDNADPYTWLVQGPGGETKSAPAACLWIPAPDPEAVGKASR 480
>TRUA_VIBVY (Q7M7J4) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 264 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 227 GERGREWSSWLVSRAPLWLAGERARADG 144 GE+ EW WL+ LAG A+A+G Sbjct: 208 GEQDPEWIKWLLEAKDRKLAGPTAKAEG 235
>TRUA_VIBVU (Q8CWK3) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 264 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 227 GERGREWSSWLVSRAPLWLAGERARADG 144 GE+ EW WL+ LAG A+A+G Sbjct: 208 GEQDPEWIKWLLEAKDRKLAGPTAKAEG 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.136 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,903,667 Number of Sequences: 219361 Number of extensions: 750694 Number of successful extensions: 2109 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2106 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)