Clone Name | bastl06d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BMP2K_HUMAN (Q9NSY1) BMP-2-inducible protein kinase (EC 2.7.11.1... | 29 | 4.5 |
---|
>BMP2K_HUMAN (Q9NSY1) BMP-2-inducible protein kinase (EC 2.7.11.1) (BIKe)| Length = 1161 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 343 HNHHVDHGNEEIYFIDWPHLSLQHGLLNQRLLVH 444 H+HH H ++ Y + H + Q +L Q+ L+H Sbjct: 488 HHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMH 521 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,372,717 Number of Sequences: 219361 Number of extensions: 778650 Number of successful extensions: 2200 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2200 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)