| Clone Name | bastl06c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SASH1_MOUSE (P59808) SAM and SH3 domain-containing protein 1 | 37 | 0.037 | 2 | CAN5_MOUSE (O08688) Calpain-5 (EC 3.4.22.-) (nCL-3) | 29 | 5.9 | 3 | CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22 | 29 | 7.7 |
|---|
>SASH1_MOUSE (P59808) SAM and SH3 domain-containing protein 1| Length = 1230 Score = 36.6 bits (83), Expect = 0.037 Identities = 27/91 (29%), Positives = 37/91 (40%) Frame = +3 Query: 150 D*CKMVTVHGFANGTSDGTANRKIKRLFNSSERKNPTNFQFERHVARLESRQQQQPRRCI 329 D K +H N T R K+L E K P+ E HV E+ Q R + Sbjct: 247 DSVKFKRLHKLVNST-----RRVRKKLIRVEEMKKPSAEGGEEHV--FENSPVQDERSAL 299 Query: 330 FTTILPIEFFHTSSEPTSPEDSLDSASSPPS 422 ++ + FF+ S PED DS + PS Sbjct: 300 YSGVHKKPFFYDGSPEKPPEDDADSLTPSPS 330
>CAN5_MOUSE (O08688) Calpain-5 (EC 3.4.22.-) (nCL-3)| Length = 640 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 12/53 (22%) Frame = -3 Query: 436 CKKIIDGGEDAESR------------LSSGDVGSDEVWKNSIGKIVVKIHRLG 314 C + +DGG A++ L+ GD+ +DE +N + + V+K+H G Sbjct: 173 CYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRG 225
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 156 ISRWPPRQGGGRSCRSAPLRSQS 88 +SR PPR+G GRS P RS+S Sbjct: 749 LSRTPPRRGRGRSYSRTPSRSRS 771 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,232,056 Number of Sequences: 219361 Number of extensions: 1245373 Number of successful extensions: 3761 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3760 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)