| Clone Name | bastl06a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSK_HAEIN (P45264) DNA translocase ftsK | 29 | 7.6 |
|---|
>FTSK_HAEIN (P45264) DNA translocase ftsK| Length = 529 Score = 28.9 bits (63), Expect = 7.6 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 157 LSLTASFQISTGYFSDSGGADSLFAADDDLYGSYRSFSLF-PHGASRTTDE 306 ++ T + +I + D GGA++L D LY S L HGA + DE Sbjct: 376 IAFTVASKIDSRTILDQGGAEALLGRGDMLYSGQGSSDLIRVHGAYMSDDE 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,229,203 Number of Sequences: 219361 Number of extensions: 519811 Number of successful extensions: 1738 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1738 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)