Clone Name | bastl06a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TCFL5_HUMAN (Q9UL49) Transcription factor-like 5 protein (Cha tr... | 29 | 6.3 | 2 | SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pr... | 28 | 8.2 | 3 | PARC_HUMAN (Q8IWT3) p53-associated parkin-like cytoplasmic prote... | 28 | 8.2 |
---|
>TCFL5_HUMAN (Q9UL49) Transcription factor-like 5 protein (Cha transcription| factor) (HPV-16 E2-binding protein 1) (E2BP-1) Length = 452 Score = 28.9 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 228 GEGAGASAGIWEKQEERKFNKFAEEKSSPNG 136 GEGA A+ G W+ E + N + +S P G Sbjct: 318 GEGATATQGAWQSSESSQANLGEQAQSGPQG 348
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -1 Query: 263 RSRPKNAQSTWMGREQEQVRGFGRSKKKENSTSLRKRNP 147 RSR K+ +S G +++ G + KKKE++ + R+P Sbjct: 369 RSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSP 407
>PARC_HUMAN (Q8IWT3) p53-associated parkin-like cytoplasmic protein| (UbcH7-associated protein 1) Length = 2517 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 109 LSLPSSVTVPIRRGFLFRKLVEFS 180 L LP+ VT P R+G++FR+ EFS Sbjct: 347 LLLPTIVTTPRRQGWVFRQRSEFS 370 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,131,199 Number of Sequences: 219361 Number of extensions: 773246 Number of successful extensions: 2182 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2182 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)