Clone Name | bastl05h12 |
---|---|
Clone Library Name | barley_pub |
>GLR34_ARATH (Q8GXJ4) Glutamate receptor 3.4 precursor (Ligand-gated ion channel| 3.4) (AtGLR4) Length = 959 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 95 RPSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 RPS V VGALFTYDS IGRAA+ A++ A+DDVNA Sbjct: 57 RPSSVNVGALFTYDSFIGRAAKPAVKAAMDDVNA 90
>GLR35_ARATH (Q9SW97) Glutamate receptor 3.5 precursor (Ligand-gated ion channel| 3.5) (Ionotropic glutamate receptor GLR6) Length = 953 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +2 Query: 98 PSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 PS V VGALFTYDS IGRAA+LA A++D+NA Sbjct: 45 PSSVNVGALFTYDSFIGRAAKLAFVAAIEDINA 77
>GLR37_ARATH (Q9SDQ4) Glutamate receptor 3.7 precursor (Ligand-gated ion channel| 3.7) (Ionotropic glutamate receptor GLR5) Length = 921 Score = 46.2 bits (108), Expect = 2e-05 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 95 RPSEVAVGALFTYDSVIGRAARLAIELAVDDVN 193 RP V +GA+F +DSVIGRAA++A+E AV DVN Sbjct: 27 RPQLVNIGAVFAFDSVIGRAAKVALEAAVSDVN 59
>GLR33_ARATH (Q9C8E7) Glutamate receptor 3.3 precursor (Ligand-gated ion channel| 3.3) Length = 933 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/34 (50%), Positives = 28/34 (82%) Frame = +2 Query: 95 RPSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 +P V +G++F++DSVIG+ A++AI+ AV DVN+ Sbjct: 25 KPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDVNS 58
>GLR36_ARATH (Q84W41) Glutamate receptor 3.6 precursor (Ligand-gated ion channel| 3.6) Length = 903 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/34 (47%), Positives = 28/34 (82%) Frame = +2 Query: 95 RPSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 RP V +G++FT++S+IG+ ++A++ AV+DVNA Sbjct: 26 RPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNA 59
>GLR31_ARATH (Q7XJL2) Glutamate receptor 3.1 precursor (Ligand-gated ion channel| 3.1) (AtGLR2) Length = 921 Score = 31.2 bits (69), Expect = 0.78 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 95 RPSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 RP + VGA+F +++ G A +A + A +DVN+ Sbjct: 26 RPPVIKVGAIFGLNTMYGETANIAFKAAEEDVNS 59
>GLR32_ARATH (Q93YT1) Glutamate receptor 3.2 precursor (Ligand-gated ion channel| 3.2) (AtGluR2) Length = 912 Score = 30.8 bits (68), Expect = 1.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 89 GPRPSEVAVGALFTYDSVIGRAARLAIELAVDDVNA 196 G RP V VGA+F+ ++ G +A++ A +DVN+ Sbjct: 24 GLRPRYVDVGAIFSLGTLQGEVTNIAMKAAEEDVNS 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,885,881 Number of Sequences: 219361 Number of extensions: 102754 Number of successful extensions: 246 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)