Clone Name | bastl05h05 |
---|---|
Clone Library Name | barley_pub |
>XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-)| Length = 915 Score = 35.4 bits (80), Expect = 0.067 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = +3 Query: 357 GFGYRLVSLVQRPNGGGLVGLLQVKRRSSTFG 452 G GYRLVS+ + P+ GG +G LQVK+++ +G Sbjct: 32 GKGYRLVSIEESPD-GGFIGYLQVKQKNKIYG 62
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 32.3 bits (72), Expect = 0.57 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 450 RRWRSGASPGGGLRGRRRWVAGRGTPAGTRTR 355 RR + G+S G G RGR R GRG+ G+R R Sbjct: 228 RRAKEGSSRGRGSRGRGRGYRGRGSRGGSRGR 259
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 32.3 bits (72), Expect = 0.57 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 450 RRWRSGASPGGGLRGRRRWVAGRGTPAGTRTR 355 RR + G+S G G RGR R GRG+ G+R R Sbjct: 228 RRAKEGSSRGRGSRGRGRGYRGRGSRGGSRGR 259
>FUT4_PANTR (Q659K9) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 405 Score = 30.8 bits (68), Expect = 1.7 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 14/67 (20%) Frame = -3 Query: 429 SPGGGLRGRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCDWPSRLRRR 292 SP GRRRW GRG P AG T W L P PW PSR Sbjct: 7 SPTAAAGGRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGV 66 Query: 291 HCWCRPW 271 W P+ Sbjct: 67 LLWWEPF 73
>CYCG_RHOS4 (Q53143) Diheme cytochrome c-type| Length = 296 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 423 GGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW 325 G GLR + RW+AG P G T P P W Sbjct: 211 GLGLRDKSRWLAGGPNPEGRGTIPNITPAKLDW 243
>PO5F1_BOVIN (O97552) POU domain, class 5, transcription factor 1| (Octamer-binding transcription factor 3) (Oct-3) (Oct-4) Length = 360 Score = 30.0 bits (66), Expect = 2.8 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = -3 Query: 435 GASPGG---GLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW---PCDWPSRLRRRHCWCRP 274 G PGG G R W++ +G P G+ P VP W PC P L +C P Sbjct: 19 GDGPGGPEPGWVDPRTWMSFQGPPGGSGIGPGVVPGAEVWGLPPCPPPYDLCGGMAYCAP 78
>NBEA_DROME (Q9W4E2) Protein neurobeachin (Protein rugose) (A-kinase anchor| protein 550) (AKAP 550) (dAKAP550) Length = 3584 Score = 29.6 bits (65), Expect = 3.7 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -3 Query: 435 GASPGGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAP-----WPCDWPSR 304 GA GGG+ + G+G P+ R RP +P+ AP P PSR Sbjct: 2458 GAGSGGGVNSGQ----GQGVPSNQRPRPEELPMKAPALVAQLPLTTPSR 2502
>XLNR_ASPNG (O42804) Transcriptional activator xlnR| Length = 875 Score = 28.5 bits (62), Expect = 8.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 354 PAWVPLPAPWPCDWPS 307 P W+PLP+P P ++PS Sbjct: 268 PGWLPLPSPSPANFPS 283
>Y4762_ARATH (Q8RY73) Protein At4g17620, chloroplast precursor| Length = 544 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 444 WRSGASPGGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 W + G G GR RW GRG P +P P P+P Sbjct: 142 WSNDNHGGRGGMGRGRWSNGRG-------GPGLLPRPGPYP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,414,349 Number of Sequences: 219361 Number of extensions: 617288 Number of successful extensions: 2372 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2367 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)