Clone Name | bastl05f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IKKB_MOUSE (O88351) Inhibitor of nuclear factor kappa B kinase b... | 29 | 5.0 | 2 | TAR1_KLULA (Q6CQE5) Protein TAR1 | 28 | 8.6 | 3 | IKKB_RAT (Q9QY78) Inhibitor of nuclear factor kappa B kinase bet... | 28 | 8.6 | 4 | CED4_CAEEL (P30429) Cell death protein 4 | 28 | 8.6 |
---|
>IKKB_MOUSE (O88351) Inhibitor of nuclear factor kappa B kinase beta subunit| (EC 2.7.11.10) (I-kappa-B-kinase beta) (IkBKB) (IKK-beta) (IKK-B) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) Length = 757 Score = 29.3 bits (64), Expect = 5.0 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -2 Query: 279 ENQFTARPTPSSVLCCLCLRPKTVADFVQLRR 184 E Q T RP P SV C L PK F QLR+ Sbjct: 398 ETQITPRPPPESVSCIL-QEPKRNLSFFQLRK 428
>TAR1_KLULA (Q6CQE5) Protein TAR1| Length = 109 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 10/51 (19%) Frame = -2 Query: 456 HGTCTLSVIEEYLGLEG--------GPPFSRKSDHHSNT--PRFTGKDRTM 334 H TC+LSV +YL L+G P S + H +N PR TG +M Sbjct: 28 HCTCSLSVSRQYLALDGIYHPLRAAFPNNSTRRKHFTNNWDPRHTGFSPSM 78
>IKKB_RAT (Q9QY78) Inhibitor of nuclear factor kappa B kinase beta subunit| (EC 2.7.11.1) (I-kappa-B-kinase beta) (IkBKB) (IKK-beta) (IKK-B) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) Length = 757 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 279 ENQFTARPTPSSVLCCLCLRPKTVADFVQLRR 184 E Q T RP P SV C L PK F Q+R+ Sbjct: 398 ETQITPRPQPESVSCVL-QEPKRNLSFFQMRK 428
>CED4_CAEEL (P30429) Cell death protein 4| Length = 571 Score = 28.5 bits (62), Expect = 8.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 225 LRPKTVADFVQLRRARYGNFSNYACC 148 +RP+ F+QL + Y + N+ACC Sbjct: 546 IRPEDFPKFMQLHQKFYDSLKNFACC 571 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,297,460 Number of Sequences: 219361 Number of extensions: 1375982 Number of successful extensions: 3193 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3190 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)