Clone Name | bastl05f07 |
---|---|
Clone Library Name | barley_pub |
>KCNC3_HUMAN (Q14003) Potassium voltage-gated channel subfamily C member 3| (Voltage-gated potassium channel subunit Kv3.3) (KSHIIID) Length = 757 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +3 Query: 12 PPHLH--SNRIAPLPPISPPS 68 PPH H S I+P PPI+PPS Sbjct: 584 PPHPHHGSGGISPPPPITPPS 604
>KCNC3_RAT (Q01956) Potassium voltage-gated channel subfamily C member 3| (Voltage-gated potassium channel subunit Kv3.3) (KSHIIID) Length = 889 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +3 Query: 12 PPHLH--SNRIAPLPPISPPS 68 PPH H S I+P PPI+PPS Sbjct: 585 PPHPHHGSGGISPPPPITPPS 605
>KCNC3_MOUSE (Q63959) Potassium voltage-gated channel subfamily C member 3| (Voltage-gated potassium channel subunit Kv3.3) (KSHIIID) Length = 769 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +3 Query: 12 PPHLH--SNRIAPLPPISPPS 68 PPH H S I+P PPI+PPS Sbjct: 584 PPHPHHGSGGISPPPPITPPS 604
>SECY_SYNP7 (P0A4H0) Preprotein translocase secY subunit| Length = 439 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 258 WALLLFIPVDVWLTGFRPTESPRCLIQT 341 WALL I + VW+T + T P IQT Sbjct: 135 WALLQSIVIAVWVTRYAVTPGPLFTIQT 162
>SECY_SYNP6 (P0A4H1) Preprotein translocase secY subunit| Length = 439 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 258 WALLLFIPVDVWLTGFRPTESPRCLIQT 341 WALL I + VW+T + T P IQT Sbjct: 135 WALLQSIVIAVWVTRYAVTPGPLFTIQT 162
>SYTL2_HUMAN (Q9HCH5) Synaptotagmin-like protein 2 (Exophilin-4)| Length = 895 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 302 ASQPNVDGNEEK*SPTLPPLLRGAARDLPS 213 +S+ G+EE+ SP L L R AAR +PS Sbjct: 465 SSRDRQQGSEEEPSPVLKTLERSAARKMPS 494
>DEMA_MOUSE (Q9WV69) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 380 SRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNE 273 S SLP GR+ L L T + G+EA P + E Sbjct: 287 SSSLPSYGRTTLSRLQSTEFSPSGSEAGSPGLQNGE 322
>ZIP8_ARATH (Q8S3W4) Probable zinc transporter 8 precursor (ZRT/IRT-like| protein 8) Length = 347 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 263 STSLHSRRRLADWLPPHRKP*VFDTDHPKLSAQYLGVTCSK 385 +TSL++++ +AD P + DH L+ + TCSK Sbjct: 146 ATSLYTKKAVADDSEERTTPMIIQIDHLPLTTKERSSTCSK 186
>KSR2_HUMAN (Q6VAB6) Kinase suppressor of ras-2 (hKSR2)| Length = 829 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 11 SPASPLQPHRTPPSHLPSLHPA-QC 82 SPA PL P TPPS LHP+ QC Sbjct: 410 SPAPPLPPSATPPS---PLHPSPQC 431
>ZIM10_HUMAN (Q9ULJ6) Retinoic acid-induced protein 17 (PIAS-like protein Zimp10)| Length = 1067 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 14 PASPLQPHRTPPSHLPSLHP 73 P P QP R PP PS HP Sbjct: 983 PPPPSQPPRQPPQAAPSSHP 1002 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,132,128 Number of Sequences: 219361 Number of extensions: 558323 Number of successful extensions: 1850 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1847 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)