| Clone Name | bastl05e12 |
|---|---|
| Clone Library Name | barley_pub |
>SIZ1_ARATH (Q680Q4) Sumoylation ligase E3 (EC 6.-.-.-) (SUMO E3 ligase)| (AtSIZ1) Length = 884 Score = 72.8 bits (177), Expect = 3e-13 Identities = 41/63 (65%), Positives = 46/63 (73%) Frame = +3 Query: 231 AGCKGKLKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQLNGLTKKPAV 410 A CK KL +FRIKELKDVL LGLSKQGKKQELVD+IL +LSD+Q L+KK V Sbjct: 5 ANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQ----AARLLSKKNTV 60 Query: 411 EKE 419 KE Sbjct: 61 AKE 63
>PIAS3_RAT (O70260) Protein inhibitor of activated STAT protein 3 (Potassium| channel-associated protein) (KChAP) Length = 628 Score = 33.5 bits (75), Expect = 0.21 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +3 Query: 243 GKLKH----FRIKELKDVLHLLGLSKQGKKQELVDKILAIL 353 G+LKH FR+ EL+ +L G +K G+K EL+ K L +L Sbjct: 5 GELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLL 45
>PIAS3_MOUSE (O54714) Protein inhibitor of activated STAT protein 3| Length = 628 Score = 33.5 bits (75), Expect = 0.21 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +3 Query: 243 GKLKH----FRIKELKDVLHLLGLSKQGKKQELVDKILAIL 353 G+LKH FR+ EL+ +L G +K G+K EL+ K L +L Sbjct: 5 GELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLL 45
>PIAS3_HUMAN (Q9Y6X2) Protein inhibitor of activated STAT protein 3| Length = 628 Score = 33.5 bits (75), Expect = 0.21 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +3 Query: 243 GKLKH----FRIKELKDVLHLLGLSKQGKKQELVDKILAIL 353 G+LKH FR+ EL+ +L G +K G+K EL+ K L +L Sbjct: 5 GELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLL 45
>PIAS4_HUMAN (Q8N2W9) Protein inhibitor of activated STAT protein 4 (Protein| inhibitor of activated STAT protein gamma) (PIAS-gamma) (PIASy) Length = 510 Score = 32.7 bits (73), Expect = 0.36 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +3 Query: 222 AVLAGCKGKLKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQL 383 A L K + FR+ +L+ +L +G SK G K ELV + L ++ Q D P+L Sbjct: 3 AELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLV--QFDCSPEL 54
>PIAS4_MOUSE (Q9JM05) Protein inhibitor of activated STAT protein 4 (Protein| inhibitor of activated STAT protein gamma) (PIAS-gamma) (PIASy) Length = 507 Score = 32.7 bits (73), Expect = 0.36 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +3 Query: 222 AVLAGCKGKLKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQL 383 A L K + FR+ +L+ +L +G SK G K ELV + L ++ Q D P+L Sbjct: 3 AELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLV--QFDCSPEL 54
>MKL1_HUMAN (Q969V6) MKL/myocardin-like protein 1 (Myocardin-related| transcription factor A) (MRTF-A) (Megakaryoblastic leukemia 1 protein) (Megacaryocytic acute leukemia protein) Length = 931 Score = 32.3 bits (72), Expect = 0.47 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 249 LKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQLNGLTKKPA 407 L ++ ELK L L L G K EL++++ A QDQ+ + G K PA Sbjct: 347 LDDMKVAELKQELKLRSLPVSGTKTELIERLRA----YQDQISPVPGAPKAPA 395
>MKL1_MOUSE (Q8K4J6) MKL/myocardin-like protein 1 (Myocardin-related| transcription factor A) (MRTF-A) (Megakaryoblastic leukemia 1 protein homolog) (Basic SAP coiled-coil transcription activator) Length = 964 Score = 32.0 bits (71), Expect = 0.61 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = +3 Query: 249 LKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQLNGLTKKPA 407 L ++ ELK L L L G K EL++++ A QDQV G K PA Sbjct: 385 LDDMKVAELKQELKLRSLPVSGTKTELIERLRA----YQDQVSPAPGAPKAPA 433
>REPS_STRAM (P36891) Replication initiator protein| Length = 459 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = +2 Query: 254 ALPNKRAKRCPASAWTFKARK----EAGIGGQD 340 A N+RA RCP+ AWT+ AG+ G D Sbjct: 73 ACGNRRASRCPSCAWTYAGDTYHLIRAGLAGDD 105
>KU70_CHICK (O93257) ATP-dependent DNA helicase 2 subunit 1 (EC 3.6.1.-)| (ATP-dependent DNA helicase II 70 kDa subunit) (Ku autoantigen protein p70 homolog) (Ku70) (DNA-repair protein XRCC6) Length = 632 Score = 30.0 bits (66), Expect = 2.3 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +3 Query: 186 ARAAMKP--ESADDAVLAGCK-GKLKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILS 356 A+A +P E ++D++ + + G L + LKD GL GKKQEL+D + S Sbjct: 571 AQAEKRPKIEISEDSLRSYVQNGTLGKLTVSALKDTCRHYGLRSGGKKQELIDALTEYFS 630
>KU70_MOUSE (P23475) ATP-dependent DNA helicase 2 subunit 1 (EC 3.6.1.-)| (ATP-dependent DNA helicase II 70 kDa subunit) (Ku autoantigen protein p70 homolog) (Ku70) (CTC box-binding factor 75 kDa subunit) (CTCBF) (CTC75) (DNA-repair protein XRCC6) Length = 607 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 240 KGKLKHFRIKELKDVLHLLGLSKQGKKQELVDKIL 344 KG L + LKD+ GL KKQEL+D ++ Sbjct: 567 KGTLGKLTVPTLKDICKAHGLKSGPKKQELLDALI 601
>PLI1_SCHPO (O94451) Sumoylation ligase E3 (EC 6.-.-.-) (Sumoylation-protein| ligase pli1) Length = 727 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 264 IKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQVPQLNGLTKKPAVEK 416 I +LKD+L + GL G K EL+ +I ++ +++ N T A++K Sbjct: 23 IPQLKDILRVFGLRLSGTKAELITRIKQLI----ERIAIENNTTSWEALKK 69
>HCC1_MOUSE (Q9D1J3) Nuclear protein Hcc-1| Length = 209 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 246 KLKHFRIKELKDVLHLLGLSKQGKKQELVDKILAILSDQQDQ 371 +L ++ ELK GL +G KQ+L++++ A L D ++ Sbjct: 6 ELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEDHAEE 47
>RPOA_OENHO (Q9MTJ3) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase alpha subunit) (RNA polymerase alpha subunit) Length = 367 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 246 KLKHFRIKELKDVLHLLGLSK 308 K+KHFRI+++K +L +L + K Sbjct: 309 KMKHFRIEDVKQILDILEIEK 329
>CPB1_CAEBR (Q6E3D0) Cytoplasmic polyadenylation element-binding protein 1| Length = 585 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 298 PSRCRTSFSSFIRKCFNLPLQPASTASSADSGFMAA 191 PS T F+ ++ N+P QP S++ +A F+AA Sbjct: 126 PSMDLTQFTEELQAIQNMPFQPISSSQAALQAFLAA 161
>LOX23_HORVU (Q8GSM2) Lipoxygenase 2.3, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:3) Length = 896 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 161 ASSHWIAPGQSRHEAGVCRRCSARRLQGQ 247 AS ++A GQ R +G R CS RRL + Sbjct: 18 ASPLFVAGGQQRRASGAGRTCSGRRLSAR 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,934,298 Number of Sequences: 219361 Number of extensions: 586512 Number of successful extensions: 2313 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2313 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)