Clone Name | bastl05d12 |
---|---|
Clone Library Name | barley_pub |
>RPK1_IPONI (P93194) Receptor-like protein kinase precursor (EC 2.7.11.1)| Length = 1109 Score = 35.0 bits (79), Expect = 0.079 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 317 ASGLDADGELLMAFRRAVTADPLGALGSWSYSDDSPCDW 433 A L++DG L++ R T+ P SW+ SD +PC W Sbjct: 21 AFALNSDGAALLSLTRHWTSIPSDITQSWNASDSTPCSW 59
>BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor (EC 2.7.11.1) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) Length = 615 Score = 33.1 bits (74), Expect = 0.30 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +2 Query: 266 MVKCVFLLVV---LALRGRGASGLDADGELLMAFRRAVTADPLGALGSWSYSDDSPCDW 433 M+ C F L++ L LR G +A+G+ L A + ++ ADP L SW + +PC W Sbjct: 6 MIPCFFWLILVLDLVLRVSG----NAEGDALSALKNSL-ADPNKVLQSWDATLVTPCTW 59
>BRL3_ARATH (Q9LJF3) Serine/threonine-protein kinase BRI1-like 3 precursor (EC| 2.7.11.1) (BRASSINOSTEROID INSENSITIVE 1-like protein 3) Length = 1164 Score = 32.7 bits (73), Expect = 0.39 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = +2 Query: 266 MVKCVFLL-VVLALRGRGASGLDA-DGELLMAFRR-AVTADPLGALGSWSY-SDDSPCDW 433 ++ C+ +L + + RGR D D LL AF++ ++ +DP LG+W Y S PC W Sbjct: 8 LILCLLVLFLTVDSRGRRLLSDDVNDTALLTAFKQTSIKSDPTNFLGNWRYGSGRDPCTW 67
>BRL1_ARATH (Q9ZWC8) Serine/threonine-protein kinase BRI1-like 1 precursor (EC| 2.7.11.1) (BRASSINOSTEROID INSENSITIVE 1-like protein 1) Length = 1166 Score = 29.6 bits (65), Expect = 3.3 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +2 Query: 266 MVKCVFLL-VVLALRGRGASGLDA-DGELLMAFRR-AVTADPLGALGSWSY-SDDSPCDW 433 ++ C F +V+ + G+ D + LL+AF++ +V +DP LG+W Y S C W Sbjct: 9 LILCFFTTSLVMGIHGKHLINDDFNETALLLAFKQNSVKSDPNNVLGNWKYESGRGSCSW 68
>INHA_BOVIN (P07994) Inhibin alpha chain precursor| Length = 360 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 278 VFLLVVLALRGRGASGLDADGELLMAFRRAVTADPLG 388 + LL++ G G GL+ D EL++A RA+ D LG Sbjct: 5 LLLLLLAPQGGHGCHGLELDRELVLAKVRALFLDALG 41
>ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 515 Score = 28.5 bits (62), Expect = 7.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 190 SFVRSFGCNCNGGQEARRR 246 +F+R GC C GG+ RRR Sbjct: 358 AFMRILGCQCRGGRRRRRR 376
>ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 514 Score = 28.5 bits (62), Expect = 7.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 190 SFVRSFGCNCNGGQEARRR 246 +F+R GC C GG+ RRR Sbjct: 357 AFMRILGCQCRGGRRRRRR 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,690,107 Number of Sequences: 219361 Number of extensions: 521673 Number of successful extensions: 1498 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1497 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)