Clone Name | bastl05c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZCH14_HUMAN (Q8WYQ9) Zinc finger CCHC domain-containing protein ... | 30 | 3.5 | 2 | UMP8_ARATH (Q9SMN1) Unknown mitochondrial protein At3g48680 | 29 | 7.8 |
---|
>ZCH14_HUMAN (Q8WYQ9) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 949 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 1 KRRGCARPPRDVSRPVSFRYSFAPPVIHISAT 96 + + C +P D +RP +FR +APP + +T Sbjct: 917 RAQDCKQPSMDFNRPGTFRLKYAPPAESLDST 948
>UMP8_ARATH (Q9SMN1) Unknown mitochondrial protein At3g48680| Length = 256 Score = 28.9 bits (63), Expect = 7.8 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -1 Query: 278 ALSSRAVNGGQIPKPSLRASPSPTFI*LDAMRRNKWG*KLIFPLSS-APKLCSNLYPSPR 102 A + AV + PKP + +PSP D ++ + G + I PL PK+ + Y +P Sbjct: 27 AAEAVAVATTETPKPKSQVTPSP-----DRVKWDYRGQRQIIPLGQWLPKVAVDAYVAPN 81 Query: 101 ILVA 90 +++A Sbjct: 82 VVLA 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,456,585 Number of Sequences: 219361 Number of extensions: 860601 Number of successful extensions: 2008 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2008 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)