| Clone Name | bastl05b11 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 128 bits (321), Expect = 1e-29 Identities = 62/115 (53%), Positives = 80/115 (69%), Gaps = 4/115 (3%) Frame = +3 Query: 159 IRDITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGS----HHHEFGSNTPR 326 IRDI AAEA++KEGD F+LIT RWWQ WI+YV QD ++GS H GS+T + Sbjct: 24 IRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQPCNTNDGSSLSEHCDSPGSSTLK 83 Query: 327 RPGAIDNTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYGGGPT 491 +P IDN++L+ D + E E+ +TL EGRDY+LLPQ+VW +L SWYGGGPT Sbjct: 84 KPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVLLPQEVWNQLRSWYGGGPT 138
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 58.5 bits (140), Expect = 9e-09 Identities = 37/104 (35%), Positives = 51/104 (49%) Frame = +3 Query: 165 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 344 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVY--------PGPID 66 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWY 476 N+ LL D D Q L + L + DYILLP + W KL SWY Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSWY 104
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 58.5 bits (140), Expect = 9e-09 Identities = 37/104 (35%), Positives = 51/104 (49%) Frame = +3 Query: 165 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 344 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVY--------PGPID 66 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWY 476 N+ LL D D Q L + L + DYILLP + W KL SWY Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSWY 104
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 57.0 bits (136), Expect = 3e-08 Identities = 32/95 (33%), Positives = 49/95 (51%) Frame = +3 Query: 195 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 374 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 375 EVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYG 479 + L + L + DY+L+P + W KL +WYG Sbjct: 81 QT------LKEHLIDELDYVLVPTEAWNKLLNWYG 109
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 57.0 bits (136), Expect = 3e-08 Identities = 32/95 (33%), Positives = 49/95 (51%) Frame = +3 Query: 195 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 374 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 375 EVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYG 479 + L + L + DY+L+P + W KL +WYG Sbjct: 81 QT------LKEHLIDELDYVLVPAEAWNKLLNWYG 109
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 51.6 bits (122), Expect = 1e-06 Identities = 32/102 (31%), Positives = 44/102 (43%), Gaps = 3/102 (2%) Frame = +3 Query: 183 EAHAKEGDIFFLITNRWWQSWIDYVI---QDSAGVPSNGSHHHEFGSNTPRRPGAIDNTN 353 E + G+ +FL+ W++ W YV QDS+ P G I+N Sbjct: 50 ERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFP-----------------GCINNAT 92 Query: 354 LLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYG 479 L D ++ L + L EG DY+LLP W L SWYG Sbjct: 93 LFQD------EINWRLKEGLVEGEDYVLLPAAAWHYLVSWYG 128
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 45.4 bits (106), Expect = 8e-05 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +3 Query: 321 PRRPGAIDNTNLLDDMASEVSDMQIE---LHDT--LAEGRDYILLPQQVWEKLHSWYG 479 P++PGAIDN L+ + + + +E L T L GRDY ++P+ VW L+ WYG Sbjct: 518 PQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYG 575 Score = 31.2 bits (69), Expect = 1.6 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 12/93 (12%) Frame = +3 Query: 201 GDIFFLITNRWWQSWIDYVIQD------------SAGVPSNGSHHHEFGSNTPRRPGAID 344 G +F+I+ +WWQ W +YV D + G S G+ H R ++ Sbjct: 393 GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLS 452 Query: 345 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 443 N ++ S+ E +T G Y P Sbjct: 453 YVNTTEEKFSDNISTASEASETAGSGFLYSATP 485
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 38.9 bits (89), Expect = 0.008 Identities = 28/107 (26%), Positives = 47/107 (43%) Frame = +3 Query: 168 ITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDN 347 + A +A G + + I+ +W++ W +V + N P PG IDN Sbjct: 803 LNKAFQAEESPG-VIYCISMQWFREWEAFV---------------KGKDNEP--PGPIDN 844 Query: 348 TNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYGGGP 488 S ++ ++ H L +G DY + ++ W L+S YGGGP Sbjct: 845 --------SRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGP 883 Score = 32.7 bits (73), Expect = 0.54 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +3 Query: 315 NTPRRPGAIDNTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQQVWEKLHSWYGGGP 488 NT PG I N L + D + ++LPQ VWE L++ +GGGP Sbjct: 720 NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLV------VILPQNVWEHLYNRFGGGP 771
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 35.0 bits (79), Expect = 0.11 Identities = 25/93 (26%), Positives = 37/93 (39%) Frame = +3 Query: 210 FFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMASEVSDM 389 F+ I+ +W++ W +V + G P PG IDNT + V Sbjct: 847 FYCISMQWFREWESFV-KGKDGDP----------------PGPIDNTKIAVTKCGNVM-- 887 Query: 390 QIELHDTLAEGRDYILLPQQVWEKLHSWYGGGP 488 L +G D + ++ W L S YGGGP Sbjct: 888 -------LRQGADSGQISEETWNFLQSIYGGGP 913 Score = 33.5 bits (75), Expect = 0.32 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 432 ILLPQQVWEKLHSWYGGGP 488 ++LPQ +W+ L+S YGGGP Sbjct: 784 LMLPQNIWDNLYSRYGGGP 802
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 33.9 bits (76), Expect = 0.24 Identities = 23/89 (25%), Positives = 37/89 (41%) Frame = +3 Query: 213 FLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMASEVSDMQ 392 FLI W++ ++D++ + G N PG I LLD+ + Sbjct: 47 FLIDYDWFEGYVDFIYGE--------------GDN----PGPITQWRLLDE--------K 80 Query: 393 IELHDTLAEGRDYILLPQQVWEKLHSWYG 479 EL +L E DY ++ +W L W+G Sbjct: 81 NELKHSLEESIDYSIVSASLWHMLVEWFG 109
>Y1052_HAEIN (P45008) Putative HTH-type transcriptional regulator HI1052| Length = 298 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +3 Query: 189 HAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHH-----HEFGSNTP 323 H KEGD+FFL N+ + Y A +P+ SH H+ G TP Sbjct: 59 HLKEGDVFFLPQNQ--PHSMHYSANKRADIPTKKSHQGLFELHQIGRGTP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,086,892 Number of Sequences: 219361 Number of extensions: 1045026 Number of successful extensions: 3397 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3365 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)