Clone Name | bastl05b06 |
---|---|
Clone Library Name | barley_pub |
>NOP14_HUMAN (P78316) Probable nucleolar complex protein 14| Length = 857 Score = 46.6 bits (109), Expect = 3e-05 Identities = 23/53 (43%), Positives = 35/53 (66%) Frame = +3 Query: 291 SNPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHKRENTLLKEFEQSAKSS 449 SNPFE +R+KF +LG+K + + SR+ A+ KR TLLKE+++ KS+ Sbjct: 29 SNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSN 81
>NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14| Length = 860 Score = 45.8 bits (107), Expect = 5e-05 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = +3 Query: 294 NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHKRENTLLKEFEQSAKSS 449 NPFE +R+KF +LG+K + + SR+ A+ KR TLLKE+++ KS+ Sbjct: 30 NPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSN 81
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 31.6 bits (70), Expect = 0.95 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +3 Query: 294 NPFEAIWSRRKFDVLGKKRKGEERRTSRSRSDAVHKRENTLLKEFEQSAKS 446 N F+ +++RKFDV G++ KG E + SR R T+ E ++ +S Sbjct: 52 NLFDRQFTKRKFDVGGRRVKGTEGKPGVSRGVGEELRRRTIGAELKKRNRS 102
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 29.6 bits (65), Expect = 3.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 411 CSPSCGQRRSGSGRCASPRPCASCRARRTCGA 316 C PSCGQ C P C S R TC + Sbjct: 101 CRPSCGQTTCCRTTCYRPSCCVSTCCRPTCSS 132
>IER5_MOUSE (O89113) Immediate early response gene 5 protein| Length = 308 Score = 28.9 bits (63), Expect = 6.2 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -3 Query: 438 RSARTP*AGCSPSCGQRRSGSGRCASPRPCASCRARRTCGATR 310 R+ R P GC P+ +R S G A P PC R G R Sbjct: 168 RAVRRP-CGCPPAVEERSSEDGSPAPPAPCPRKRGAAGVGGGR 209
>MS87F_DROME (P08175) Male-specific sperm protein Mst87F| Length = 56 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 411 CSPSCGQRRSGSGRCASPRPCASCRARRTCG 319 C CG G G C P C C A CG Sbjct: 17 CCGPCGPCGGGCGPCYGPNVCGPCYACGPCG 47
>APLP_MANSE (Q25490) Apolipophorins precursor [Contains: Apolipophorin-2| (Apolipophorin II) (apoLp-2); Apolipophorin-1 (Apolipophorin I) (apoLp-1)] Length = 3305 Score = 28.9 bits (63), Expect = 6.2 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 411 CSPSCGQRRSGSGRCASPR-PCASCRARRTCGATRW 307 C + G RRS S C PR P +C AR G W Sbjct: 2962 CDLARGYRRSRSRGCCPPRCPTPACAARTATGPGSW 2997 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.124 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,086,717 Number of Sequences: 219361 Number of extensions: 398484 Number of successful extensions: 2101 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2095 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)