Clone Name | bastl04h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GCP_CAEEL (Q10663) Bifunctional glyoxylate cycle protein (GEX-in... | 31 | 0.73 | 2 | AT5G1_SHEEP (P17605) ATP synthase lipid-binding protein, mitocho... | 28 | 6.2 | 3 | SKN1_CANAL (P87024) Beta-glucan synthesis-associated protein SKN1 | 28 | 6.2 |
---|
>GCP_CAEEL (Q10663) Bifunctional glyoxylate cycle protein (GEX-interacting| protein 7) [Includes: Isocitrate lyase (EC 4.1.3.1) (Isocitrase) (Isocitratase) (ICL); Malate synthase (EC 2.3.3.9)] Length = 968 Score = 31.2 bits (69), Expect = 0.73 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -3 Query: 117 ALVRARVKRKEREAGNGHDGRWWNGIQWAPLSRR 16 ALVRA KEREA +GHDG W PL++R Sbjct: 783 ALVRAD---KEREATDGHDGTWVAHPGLVPLAKR 813
>AT5G1_SHEEP (P17605) ATP synthase lipid-binding protein, mitochondrial| precursor (EC 3.6.3.14) (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) Length = 136 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 163 SKPEIPSSQKIYSSLPLYICPAHFLLS 243 S+PEIPS Q YSS PL + F S Sbjct: 31 SRPEIPSVQPSYSSGPLQVARREFQTS 57
>SKN1_CANAL (P87024) Beta-glucan synthesis-associated protein SKN1| Length = 737 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 82 SLFPLDSRPHQSLKNTAQNATS*WLRNSKPEIPSSQ----KIYSSLPLYICP 225 SL+ ++R HQ L + N ++ + N++ IPS Q +YS+ P+ P Sbjct: 75 SLYQSETRFHQPLLHNDSNNSNSSIGNNRQRIPSQQHDTSSLYSASPISTSP 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,210,347 Number of Sequences: 219361 Number of extensions: 531570 Number of successful extensions: 1107 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1107 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)