Clone Name | bastl04h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RV167_YEAST (P39743) Reduced viability upon starvation protein 167 | 31 | 1.2 | 2 | GCNL2_MOUSE (Q9JHD2) General control of amino acid synthesis pro... | 28 | 7.7 |
---|
>RV167_YEAST (P39743) Reduced viability upon starvation protein 167| Length = 482 Score = 31.2 bits (69), Expect = 1.2 Identities = 31/113 (27%), Positives = 40/113 (35%), Gaps = 2/113 (1%) Frame = +3 Query: 48 RRKQSLATAV--PVTGXXXXXXXXXXXXXXXXLYIASTSASASPQGRGEPEHARSHASQP 221 RRK +ATA PV+G Y +T+ S +P G G A S+A+QP Sbjct: 288 RRKYGVATAEGSPVSGASSGVGYGAG-------YDPATATSPTPTGYGYGAAAPSYAAQP 340 Query: 222 AAMXXXXXXXXXXXXXXXXXXXXWWGGNAGTAEAQAPVFACDASNATLAAYGF 380 AA G AG P +A A + L GF Sbjct: 341 AAQYGTAAAVGTAAAVGTAA-----GAAAGAVPGTYPQYAA-AQSPPLTGLGF 387
>GCNL2_MOUSE (Q9JHD2) General control of amino acid synthesis protein 5-like 2| (EC 2.3.1.48) (Histone acetyltransferase GCN5) (mmGCN5) Length = 830 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 441 PASAATPGPWRAPTPSPS 388 PASA+TP P AP P+P+ Sbjct: 34 PASASTPAPTPAPAPAPA 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,932,312 Number of Sequences: 219361 Number of extensions: 477045 Number of successful extensions: 2450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2434 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)