Clone Name | bastl04e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KRIT1_MOUSE (Q6S5J6) Krev interaction trapped protein 1 (Krev in... | 28 | 6.6 | 2 | L_MUMPM (P30929) Large structural protein (Protein L) (Transcrip... | 28 | 8.6 |
---|
>KRIT1_MOUSE (Q6S5J6) Krev interaction trapped protein 1 (Krev interaction| trapped 1) (Cerebral cavernous malformations 1 protein homolog) Length = 736 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 25 SELELGLLSLAVASSKP*RHRQEGPPGSQIAAAMESPVK-EEVGGELAMEIESSVTAED 198 SE+ G+L V ++KP +G G ++ + P+ E+ G E A+ I SV ++ Sbjct: 62 SEIAQGILDYVVETTKPISPANQGIKGKRVVLMRKFPLDGEKTGREAALFIVPSVVKDN 120
>L_MUMPM (P30929) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2261 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 159 LPADLLLHGALHRGGDLAPRRAFLPMPLGF 70 LP +++ + +L G+ P+R F P+P F Sbjct: 1828 LPGEIIWYNSLFNSGENPPQRNFAPLPTQF 1857 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.129 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,816,113 Number of Sequences: 219361 Number of extensions: 344804 Number of successful extensions: 1038 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)