Clone Name | bastl04c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_IBDVA (P12918) RNA-directed RNA polymerase (EC 2.7.7.48) (R... | 30 | 2.7 | 2 | RDRP_IBDV (Q9Q6Q5) RNA-directed RNA polymerase (EC 2.7.7.48) (RD... | 30 | 4.5 | 3 | RDRP_IBDV5 (P31817) RNA-directed RNA polymerase (EC 2.7.7.48) (R... | 30 | 4.5 | 4 | FGD5_MOUSE (Q80UZ0) FYVE, RhoGEF and PH domain-containing protein 5 | 29 | 7.7 |
---|
>RDRP_IBDVA (P12918) RNA-directed RNA polymerase (EC 2.7.7.48) (RDRP) (Protein| VP1) Length = 878 Score = 30.4 bits (67), Expect = 2.7 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +3 Query: 267 DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ 446 D G FNQ S M L V+ M+L + + G+G + N++ +S+L+ Sbjct: 442 DNGDPMFNQTWASFAMNIAPALVVDSSCLIMNLQIKSYGQGSGNAATFINNHLLSTLVLD 501 Query: 447 KANILK 464 + N++K Sbjct: 502 QWNLMK 507
>RDRP_IBDV (Q9Q6Q5) RNA-directed RNA polymerase (EC 2.7.7.48) (RDRP) (Protein| VP1) Length = 881 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +3 Query: 267 DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ 446 D G FNQ + M L V+ M+L + T G+G + N++ +S+L+ Sbjct: 443 DNGDPMFNQTWATFAMNIAPALVVDSSCLIMNLQIKTYGQGSGNAATFINNHLLSTLVLD 502 Query: 447 KANILK 464 + N+++ Sbjct: 503 QWNLMR 508
>RDRP_IBDV5 (P31817) RNA-directed RNA polymerase (EC 2.7.7.48) (RDRP) (Protein| VP1) (Fragment) Length = 525 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +3 Query: 267 DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ 446 D G FNQ + M L V+ M+L + T G+G + N++ +S+L+ Sbjct: 117 DNGDPMFNQTWATFAMNIAPALVVDSSCLIMNLQIKTYGQGSGNAATFINNHLLSTLVLD 176 Query: 447 KANILK 464 + N+++ Sbjct: 177 QWNLMR 182
>FGD5_MOUSE (Q80UZ0) FYVE, RhoGEF and PH domain-containing protein 5| Length = 1219 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 284 LQPGNIFPHDGMVSRARGGDGENRHVFISEYTI 382 LQPG F +G + R RG RH+F+ T+ Sbjct: 864 LQPGREFLKEGTLMRVRGKSRHPRHLFLMNDTL 896 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,921,483 Number of Sequences: 219361 Number of extensions: 1023995 Number of successful extensions: 3164 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3163 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)