Clone Name | bastl04c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | JDP_BOMMO (Q9U6V7) J domain-containing protein | 29 | 3.1 | 2 | AMID_PSECL (P27765) Amidase (EC 3.5.1.4) | 29 | 4.0 | 3 | KLF2_RAT (Q9ET58) Krueppel-like factor 2 (Lung krueppel-like fac... | 28 | 5.3 | 4 | KLF2_MOUSE (Q60843) Krueppel-like factor 2 (Lung krueppel-like f... | 28 | 5.3 | 5 | ACOX_RALEU (P27748) Acetoin catabolism protein X | 28 | 6.9 | 6 | REV_HV2SB (P12448) REV protein (Anti-repression transactivator p... | 28 | 9.0 |
---|
>JDP_BOMMO (Q9U6V7) J domain-containing protein| Length = 170 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 4 RLIKASRKLPTPPSNLGSARPARNKHRAGGRRSWER 111 R+++ P+ PS+LG + PA + GG W R Sbjct: 114 RMLEGDGSKPSGPSSLGPSNPATRRASEGGAALWGR 149
>AMID_PSECL (P27765) Amidase (EC 3.5.1.4)| Length = 505 Score = 28.9 bits (63), Expect = 4.0 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 43 SNLGSARPARNKHR----AGGRRSWERAMAAKGTTEMEVGGD 156 S+ P N HR +GG S A+ A G ++ VGGD Sbjct: 151 SHTSDPAPVHNPHRHGYASGGSSSGSAALVASGEVDIAVGGD 192
>KLF2_RAT (Q9ET58) Krueppel-like factor 2 (Lung krueppel-like factor)| Length = 351 Score = 28.5 bits (62), Expect = 5.3 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 16 ASRKLPTPPSN---LGSARPARNKHRAGGRRSWERAMAAKGT 132 A+R L TPPS+ L A+P R GRRSW R AA T Sbjct: 234 ATRGLLTPPSSPLELLEAKPKR------GRRSWPRKRAATHT 269
>KLF2_MOUSE (Q60843) Krueppel-like factor 2 (Lung krueppel-like factor)| Length = 354 Score = 28.5 bits (62), Expect = 5.3 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 16 ASRKLPTPPSN---LGSARPARNKHRAGGRRSWERAMAAKGT 132 A+R L TPPS+ L A+P R GRRSW R AA T Sbjct: 237 ATRGLLTPPSSPLELLEAKPKR------GRRSWPRKRAATHT 272
>ACOX_RALEU (P27748) Acetoin catabolism protein X| Length = 359 Score = 28.1 bits (61), Expect = 6.9 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 143 SISVVPLAAIARSQDRLPPARCLFLAGLAEPRLLGGVGSLR 21 ++ + + AR D L ARC+ AG+A +LGG G+ R Sbjct: 90 AVDYLDMPVTARVDDTLRAARCMADAGVAAIIVLGGDGTHR 130
>REV_HV2SB (P12448) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 168 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 4 RLIKASRKLPTPPSNLGSARPARNKHRAGGRRSWERAMA 120 RLI+ + P LG+AR RN+ R RR W++ +A Sbjct: 15 RLIRLLHQTNPYPQGLGTARQRRNRRRRWERR-WKQILA 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.127 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,622,249 Number of Sequences: 219361 Number of extensions: 299694 Number of successful extensions: 882 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)