| Clone Name | bastl04b11 |
|---|---|
| Clone Library Name | barley_pub |
>K125_TOBAC (O23826) 125 kDa kinesin-related protein| Length = 1006 Score = 60.1 bits (144), Expect = 3e-09 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 338 VNIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANNRL 472 VN+QVLLRCRP S +EL N P V+TCN+ +REV+ +QNIA + Sbjct: 8 VNVQVLLRCRPFSNDELRNNAPQVVTCNDYQREVAVSQNIAGKHI 52
>K125_ARATH (P82266) Probable 125 kDa kinesin-related protein| Length = 1056 Score = 59.3 bits (142), Expect = 5e-09 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 338 VNIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANNRL 472 VN+QVLLRCRP S +EL N P V+TCN+ +REV+ +QNIA + Sbjct: 11 VNVQVLLRCRPFSDDELRSNAPQVLTCNDLQREVAVSQNIAGKHI 55
>EG51_XENLA (P28025) Kinesin-related motor protein Eg5 1| Length = 1060 Score = 39.3 bits (90), Expect = 0.006 Identities = 18/49 (36%), Positives = 30/49 (61%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANNRLIEHLY 487 NIQV++RCRP ++ E ++ V+ C+ QR+EV N++L + Y Sbjct: 11 NIQVVVRCRPFNQLERKASSHSVLECDSQRKEVYVRTGEVNDKLGKKTY 59
>EG52_XENLA (Q91783) Kinesin-related motor protein Eg5 2| Length = 1067 Score = 39.3 bits (90), Expect = 0.006 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANNRLIEHLY 487 NIQV++RCRP ++ E ++ V+ C QR+EV N++L + Y Sbjct: 18 NIQVVVRCRPFNQLERKASSHSVLECESQRKEVCVRTGEVNDKLGKKTY 66
>KIF11_HUMAN (P52732) Kinesin-like protein KIF11 (Kinesin-related motor protein| Eg5) (Kinesin-like spindle protein HKSP) (Thyroid receptor-interacting protein 5) (TRIP5) (Kinesin-like protein 1) Length = 1057 Score = 33.9 bits (76), Expect = 0.24 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVS 442 NIQV++RCRP + E + ++ C+ R+EVS Sbjct: 18 NIQVVVRCRPFNLAERKASAHSIVECDPVRKEVS 51
>KLP68_DROME (P46867) Kinesin-like protein KLP68D| Length = 784 Score = 30.8 bits (68), Expect = 2.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 344 IQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANNR 469 +QV++RCRP+S E S +P V+ R V + N+ Sbjct: 20 VQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNK 61
>KIF3A_PONPY (Q5R4H3) Kinesin-like protein KIF3A (Microtubule plus end-directed| kinesin motor 3A) Length = 702 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANN 466 N++V++RCRPL++ E S+ ++ +E R ++ + ++N Sbjct: 14 NVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSN 55
>KIF3A_MACFA (Q4R628) Kinesin-like protein KIF3A (Microtubule plus end-directed| kinesin motor 3A) Length = 702 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANN 466 N++V++RCRPL++ E S+ ++ +E R ++ + ++N Sbjct: 14 NVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSN 55
>KIF3A_HUMAN (Q9Y496) Kinesin-like protein KIF3A (Microtubule plus end-directed| kinesin motor 3A) Length = 702 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANN 466 N++V++RCRPL++ E S+ ++ +E R ++ + ++N Sbjct: 14 NVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSN 55
>KIF3A_MOUSE (P28741) Kinesin-like protein KIF3A (Microtubule plus end-directed| kinesin motor 3A) Length = 701 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQRREVSAAQNIANN 466 N++V++RCRPL++ E S+ ++ +E R ++ + ++N Sbjct: 14 NVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSN 55
>NU1M_SMICR (O78715) NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (NADH| dehydrogenase subunit 1) Length = 318 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 462 FAMFWAAETSRLCSLQVITTGVFMLSSSLLKGLH 361 FAMF+ AE + + ++ ITT +FM SS L H Sbjct: 220 FAMFFLAEYANIIAMNAITTILFMGSSLTLNLTH 253
>KIF17_MOUSE (Q99PW8) Kinesin-like protein KIF17 (MmKIF17)| Length = 1038 Score = 28.9 bits (63), Expect = 7.8 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +2 Query: 341 NIQVLLRCRPLSKEELSINTPVVITCNEQR 430 +++V++RCRP++K E ++ V+T + R Sbjct: 5 SVKVVVRCRPMNKRERELSCQSVVTVDSAR 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,083,894 Number of Sequences: 219361 Number of extensions: 808289 Number of successful extensions: 2408 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2407 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)