Clone Name | bastl04a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IPHP_NOSCO (Q05918) Tyrosine-protein phosphatase precursor (EC 3... | 33 | 0.33 | 2 | DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleo... | 32 | 0.74 |
---|
>IPHP_NOSCO (Q05918) Tyrosine-protein phosphatase precursor (EC 3.1.3.48)| Length = 294 Score = 33.1 bits (74), Expect = 0.33 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +3 Query: 297 AMARDAAVLFQSRRYAECAEVLAQLLLKKEGDPK--VLHNMAIAESFVDGCP 446 A +D AVLF + ++A LLL G PK ++HN AI+ +++G P Sbjct: 171 AAQQDGAVLFHCTAGKDRTGIIAGLLLDLAGVPKAEIVHNYAISAHYLEGQP 222
>DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 588 Score = 32.0 bits (71), Expect = 0.74 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 178 ERGCDTRTPDSRADAANWSTGGRVWSWGGLARVWTRWRWDT 56 E GC+ S AD + + G R W W L R + WDT Sbjct: 396 EDGCEGLVAKSMADDSYYKAGARGWLWIKLKRDYQAQLWDT 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,570,131 Number of Sequences: 219361 Number of extensions: 565553 Number of successful extensions: 1760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1759 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)