| Clone Name | bastl03g04 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 62.0 bits (149), Expect = 5e-10 Identities = 24/41 (58%), Positives = 37/41 (90%) Frame = +2 Query: 293 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTHDMWPVL 415 ++A+ +V+YDH+A++I+G +R+L+SGSIHYPRST +MWP L Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDL 60
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 61.6 bits (148), Expect = 7e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +2 Query: 290 GTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTHDMWPVL 415 G++ +T V++D RA+ IDG RR+L+SGSIHYPRST DMWP L Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSDMWPDL 61
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 60.8 bits (146), Expect = 1e-09 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +2 Query: 296 SAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTHDMWPVL 415 + +VTYDH++++I+G RR+L+SGSIHYPRST +MWP L Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDL 61
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 58.9 bits (141), Expect = 5e-09 Identities = 22/36 (61%), Positives = 33/36 (91%) Frame = +2 Query: 308 NVTYDHRALVIDGVRRVLVSGSIHYPRSTHDMWPVL 415 +V+YDH+A++++G R++L+SGSIHYPRST +MWP L Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDL 58
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 54.3 bits (129), Expect = 1e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 308 NVTYDHRALVIDGVRRVLVSGSIHYPRSTHDMWP 409 NV YD+RA+ I+ RR+L+SGSIHYPRST +MWP Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPEMWP 63
>TTGH_PSEPU (Q93PU4) Toluene efflux pump membrane transporter ttgH| Length = 1049 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 215 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 129 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>SRPB_PSEPU (O31100) Solvent resistant pump membrane transporter srpB| Length = 1049 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 215 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 129 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,113,369 Number of Sequences: 219361 Number of extensions: 371707 Number of successful extensions: 1334 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1334 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)