Clone Name | bastl03f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IRS2_MOUSE (P81122) Insulin receptor substrate 2 (IRS-2) (4PS) | 30 | 2.6 | 2 | Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92) | 28 | 9.7 | 3 | GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4) (End... | 28 | 9.7 |
---|
>IRS2_MOUSE (P81122) Insulin receptor substrate 2 (IRS-2) (4PS)| Length = 1321 Score = 30.4 bits (67), Expect = 2.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 2 THPRRQRQTPARADGKLDTYAMERVALLRTSGR 100 T P RQRQ P + LD Y + R +SGR Sbjct: 575 TTPARQRQVPQPSSASLDEYTLMRATFSGSSGR 607
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 3 PTPAGKGKPQPEPTASWTPTP 65 PTP P P PT S TPTP Sbjct: 117 PTPTPSPTPSPTPTPSPTPTP 137
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 3 PTPAGKGKPQPEPTASWTPTP 65 P+P+ P P P+AS TPTP Sbjct: 409 PSPSVSPSPSPSPSASRTPTP 429 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,817,192 Number of Sequences: 219361 Number of extensions: 439396 Number of successful extensions: 2762 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2699 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)