| Clone Name | bastl03f04 |
|---|---|
| Clone Library Name | barley_pub |
>JUN_COTJA (P12981) Transcription factor AP-1 (Proto-oncogene c-jun)| Length = 313 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 102 PSPTLDEPPGDFASIPIRTQLAGGDFSEGLDSEPGMYGQGGGFNPHFRHAA 254 PS T P P+ + GG F+ L SEP +Y FNP+ ++A Sbjct: 127 PSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSA 177
>JUN_CHICK (P18870) Transcription factor AP-1 (Proto-oncogene c-jun)| Length = 314 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 102 PSPTLDEPPGDFASIPIRTQLAGGDFSEGLDSEPGMYGQGGGFNPHFRHAA 254 PS T P P+ + GG F+ L SEP +Y FNP+ ++A Sbjct: 128 PSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSA 178
>JUN_AVIS1 (P05411) Viral jun transforming protein (v-Jun)| Length = 287 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 102 PSPTLDEPPGDFASIPIRTQLAGGDFSEGLDSEPGMYGQGGGFNPHFRHAA 254 PS T P P+ + GG F+ L SEP +Y FNP+ ++A Sbjct: 101 PSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSA 151
>NMD3A_HUMAN (Q8TCU5) Glutamate [NMDA] receptor subunit 3A precursor| (N-methyl-D-aspartate receptor subtype NR3A) (NMDAR-L) Length = 1115 Score = 29.6 bits (65), Expect = 4.6 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 205 PGSESKPSLKSPPASWVRIGIEAKSPGGSSRVGDGRRLPAV 83 PG+ P+ SP A W+ + + P GS + G+G R A+ Sbjct: 83 PGTRRSPA-PSPGARWLGSTLHGRGPPGSRKPGEGARAEAL 122
>TSH_DROME (P22265) Protein teashirt| Length = 954 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 87 AGKRRPSPTLDEPPGDFASIPIRTQLAGGDFSEGLDSEPGMYGQGGGFNP 236 AG R P P +E F P + A + SE LD +YG+ P Sbjct: 122 AGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEP 171
>HXD4_CHICK (P17278) Homeobox protein Hox-D4 (Chox-A)| Length = 235 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 226 PPPCPYIPGSESKPSLKSPPASWVR 152 PPPCP IP +P+LK+P S V+ Sbjct: 95 PPPCP-IPSCGQQPALKAPHGSAVK 118
>CATA_MYCIT (Q04657) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| (MI85 protein) Length = 746 Score = 29.3 bits (64), Expect = 6.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 164 ELGSNWNRSEISGGLVEGR*RAALAGSWLLTSDE 63 ++G+ W SE + + EGR RA+ A W T+++ Sbjct: 668 DMGTEWKASETAENVYEGRDRASGALKWTATAND 701
>SMR1_MOUSE (Q61900) Submaxillary gland androgen-regulated protein 1 precursor| (Salivary protein MSG1) Length = 147 Score = 28.9 bits (63), Expect = 7.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 226 PPPCPYIPGSESKPSLKSPP 167 PPPCP +P PS SPP Sbjct: 76 PPPCPPVPPHPRPPSNPSPP 95
>ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger protein of the| cerebellum 5) Length = 639 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -3 Query: 226 PPPCPYIPGSESKPSLKSPPASWVRIGIEAKSPGGSSRVGDG 101 PPP P +P + S P PP G + GG G G Sbjct: 127 PPPAPPLPPTPSPPPPPPPPPPPALSGYTTTNSGGGGSSGKG 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,694,506 Number of Sequences: 219361 Number of extensions: 960806 Number of successful extensions: 3786 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3782 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)