Clone Name | bastl03d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | XYNA_THENE (Q60042) Endo-1,4-beta-xylanase A precursor (EC 3.2.1... | 32 | 0.71 | 2 | XYNA_THEMA (Q60037) Endo-1,4-beta-xylanase A precursor (EC 3.2.1... | 29 | 7.8 |
---|
>XYNA_THENE (Q60042) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) (Endoxylanase) Length = 1055 Score = 32.3 bits (72), Expect = 0.71 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +2 Query: 248 ASEKVITENILPNGDFSEDLRLWHPNGCHVFVAVEGSGYHNGIKPHSGSKYAVVTHRTQS 427 A KV+ E F + + W P G V +++ HSG K V++R + Sbjct: 196 AGPKVVYET-----SFEKGIGDWQPRGSDVKISISPK------VAHSGKKSLFVSNRQKG 244 Query: 428 WQGLEQVLENI-RVGTKYIVTAYV 496 W G + L+ I + G Y A+V Sbjct: 245 WHGAQISLKGILKTGKTYAFEAWV 268
>XYNA_THEMA (Q60037) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) Length = 1059 Score = 28.9 bits (63), Expect = 7.8 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = +2 Query: 257 KVITENILPNGDFSEDLRLWHPNGCHVFVAVEGSGYHNGIKPHSGSKYAVVTHRTQSWQG 436 KVI E NG + W P G V +E S HSG +++R + WQG Sbjct: 204 KVIYETSFENG-----VGDWQPRGD---VNIEASSE----VAHSGKSSLFISNRQKGWQG 251 Query: 437 LEQVLENI-RVGTKYIVTAYV 496 + L+ I + G Y A+V Sbjct: 252 AQINLKGILKTGKTYAFEAWV 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,263,965 Number of Sequences: 219361 Number of extensions: 1099032 Number of successful extensions: 2276 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2274 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)