| Clone Name | bastl02h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLYG_MOUSE (Q9R062) Glycogenin-1 (EC 2.4.1.186) | 43 | 3e-04 | 2 | GLYG_RAT (O08730) Glycogenin-1 (EC 2.4.1.186) | 41 | 0.001 | 3 | GLYG_HUMAN (P46976) Glycogenin-1 (EC 2.4.1.186) | 41 | 0.001 | 4 | GLYG_RABIT (P13280) Glycogenin-1 (EC 2.4.1.186) | 39 | 0.007 | 5 | GLYG2_HUMAN (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) | 37 | 0.015 | 6 | HUWE1_MOUSE (Q7TMY8) HECT, UBA and WWE domain-containing protein... | 28 | 9.0 | 7 | HUWE1_HUMAN (Q7Z6Z7) HECT, UBA and WWE domain-containing protein... | 28 | 9.0 |
|---|
>GLYG_MOUSE (Q9R062) Glycogenin-1 (EC 2.4.1.186)| Length = 332 Score = 43.1 bits (100), Expect = 3e-04 Identities = 23/51 (45%), Positives = 31/51 (60%) Frame = +3 Query: 189 TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRXLLE 341 T++A+VTL D + G VLG S++ T R MVVL S VS+ R +LE Sbjct: 1 TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLE 51
>GLYG_RAT (O08730) Glycogenin-1 (EC 2.4.1.186)| Length = 332 Score = 40.8 bits (94), Expect = 0.001 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +3 Query: 189 TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRXLLE 341 T++A+VTL D + G VLG S++ T R VVL S VS+ R +LE Sbjct: 1 TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRTVVLASPQVSDSMRKVLE 51
>GLYG_HUMAN (P46976) Glycogenin-1 (EC 2.4.1.186)| Length = 349 Score = 40.8 bits (94), Expect = 0.001 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = +3 Query: 189 TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRXLLE 341 T++A+VTL D + G VLG S++ T R +VVL + VS+ R +LE Sbjct: 1 TDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLE 51
>GLYG_RABIT (P13280) Glycogenin-1 (EC 2.4.1.186)| Length = 332 Score = 38.5 bits (88), Expect = 0.007 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +3 Query: 189 TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRXLLE 341 T++A+VTL D + G VLG S++ T R + VL + VS+ R LE Sbjct: 1 TDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALE 51
>GLYG2_HUMAN (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2)| Length = 501 Score = 37.4 bits (85), Expect = 0.015 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +3 Query: 189 TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRXLL 338 T++A+VTL D + G VLG+S+R R +VVL++ VS R +L Sbjct: 35 TDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVIL 84
>HUWE1_MOUSE (Q7TMY8) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (E3Histone) Length = 4377 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 344 SLEEPPRVLGDAVGDEHDHVAPRAGVADGLAQDAHAEDELVAV 216 S ++ P G+A E DH + VADG D AE + V + Sbjct: 2288 SHQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVI 2330
>HUWE1_HUMAN (Q7Z6Z7) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (Mcl-1 ubiquitin ligase E3) (Mule) (ARF-binding protein 1) (ARF-BP1) Length = 4374 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 344 SLEEPPRVLGDAVGDEHDHVAPRAGVADGLAQDAHAEDELVAV 216 S ++ P G+A E DH + VADG D AE + V + Sbjct: 2288 SNQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVI 2330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,749,799 Number of Sequences: 219361 Number of extensions: 494468 Number of successful extensions: 1583 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1583 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)