Clone Name | bastl02h01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9) | 28 | 5.7 | 2 | EPOR_MOUSE (P14753) Erythropoietin receptor precursor (EPO-R) | 28 | 7.4 | 3 | TLR11_MOUSE (Q6R5P0) Toll-like receptor 11 precursor | 28 | 7.4 | 4 | GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; C... | 27 | 9.7 |
---|
>MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9)| Length = 567 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 190 VVGQVVERFRARLREEAGEEPKAAAVVGVYKEALAELTFNC 312 V G+VVE AR+ E G+E G+YKEA T C Sbjct: 501 VFGRVVEEEMARIEREVGKEKFKK---GMYKEACKIFTRQC 538
>EPOR_MOUSE (P14753) Erythropoietin receptor precursor (EPO-R)| Length = 507 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 64 PAWPCFASACLLLVASLPNPSPRRPFPE 147 P WP CLLL + PSP P P+ Sbjct: 7 PLWPRVGPLCLLLAGAAWAPSPSLPDPK 34
>TLR11_MOUSE (Q6R5P0) Toll-like receptor 11 precursor| Length = 926 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 25 SCSCKSQINPNTFPAWPCFASACLLLVASLPNPSPRRPFPETLDL 159 SC K Q FP LL +S PN P PF ETLDL Sbjct: 187 SCLTKFQDLQRLFPD-------LLLSTSSTPNIKPGAPFLETLDL 224
>GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; Core protein| p18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 612 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +1 Query: 49 NPNTFPAWPCFASACLLLVASLPNPSPRRPFPETLDLPMXXXXXXXPVVGQVVERF 216 N NTFP+ P F A V + +P P P P P+ +G+VV F Sbjct: 197 NNNTFPSAPPFPPAYTPTVMAGLDPPPGFPPPSKHMSPLQKALRQAQRLGEVVSDF 252 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,318,563 Number of Sequences: 219361 Number of extensions: 437957 Number of successful extensions: 1121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)