Clone Name | bastl02d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GSCR1_HUMAN (Q9NZM4) Glioma tumor suppressor candidate region ge... | 30 | 3.2 |
---|
>GSCR1_HUMAN (Q9NZM4) Glioma tumor suppressor candidate region gene 1 protein| Length = 1509 Score = 30.0 bits (66), Expect = 3.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -2 Query: 226 FPL*FP*DH--HKIPNRPPPL*LYNESATKPPPP 131 F L FP HK P PP L L E A PPPP Sbjct: 855 FQLQFPPSQGPHKSPTPPPTLHLVPEPAAPPPPP 888 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,597,035 Number of Sequences: 219361 Number of extensions: 1210088 Number of successful extensions: 2290 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2286 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)