| Clone Name | bastl02b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YB89_YEAST (P38140) Putative 60.3 kDa transcriptional regulatory... | 35 | 0.11 | 2 | RL15_METCA (Q605D1) 50S ribosomal protein L15 | 32 | 0.91 | 3 | TYCB_BREPA (O30408) Tyrocidine synthetase 2 (Tyrocidine syntheta... | 32 | 1.2 | 4 | CYB5_HUMAN (P00167) Cytochrome b5 | 29 | 7.7 | 5 | RMT2_CRYNE (Q5KP51) Arginine N-methyltransferase 2 (EC 2.1.1.-) | 29 | 7.7 |
|---|
>YB89_YEAST (P38140) Putative 60.3 kDa transcriptional regulatory protein in| PRP5-THI2 intergenic region Length = 529 Score = 35.0 bits (79), Expect = 0.11 Identities = 28/103 (27%), Positives = 44/103 (42%) Frame = +2 Query: 152 SECDDPPFNHSNLEAHLLETIRDLYEEAFERLPVHAMPVEAADQLAISMRKGGLCLGLLD 331 S + P +++ E +E IR LY E +P H P +++Q S+ G ++ Sbjct: 181 SSNNSPTGTNTSPEETEMEKIRQLYSEQRANIPPH--PYPSSNQNVYSILLGPNSAKIVA 238 Query: 332 PVANIILNTIALLPHDFGDMADKRRSKRLAGRRDSSSSWNTSW 460 N+ N L+P D D + KRL R S S +W Sbjct: 239 SQVNLFANHFPLVPVDSAD--NSLNFKRLLPRDPSEKSSQINW 279
>RL15_METCA (Q605D1) 50S ribosomal protein L15| Length = 144 Score = 32.0 bits (71), Expect = 0.91 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 9/52 (17%) Frame = -3 Query: 277 GGFHRHGVDG--QPLERLLVQVADGLQKMGF-------QIGMVEGGIVALAE 149 GGFH+ G +G PL+R L +V K F QI V GG++ LAE Sbjct: 43 GGFHKVGFEGGQMPLQRRLPKVGFRSAKKRFVAEVTLTQISKVGGGVIGLAE 94
>TYCB_BREPA (O30408) Tyrocidine synthetase 2 (Tyrocidine synthetase II)| [Includes: ATP-dependent proline adenylase (ProA) (Proline activase); ATP-dependent phenylalanine adenylase (PheA) (Phenylalanine activase); ATP-dependent D-phenylalanine adenylase (D Length = 3587 Score = 31.6 bits (70), Expect = 1.2 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 17/83 (20%) Frame = +2 Query: 173 FNHSNLEAHLLETIRDLYEEAFERLPVHAMPV------------EAADQLAISMRKGG-- 310 FN ++ E +TI+ L+EE E++P H V E A+QLA +R+ G Sbjct: 2533 FNDTHREYRADQTIQQLFEELAEKMPEHTALVFEEKRMSFRELNERANQLAAVLREKGVG 2592 Query: 311 ---LCLGLLDPVANIILNTIALL 370 + L++ A +++ T+A L Sbjct: 2593 PAQIVALLVERSAEMVIATLATL 2615
>CYB5_HUMAN (P00167) Cytochrome b5| Length = 133 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 431 DSSSSWNTSWVVPSSGVV 484 DSSSSW T+WV+P+ V Sbjct: 103 DSSSSWWTNWVIPAISAV 120
>RMT2_CRYNE (Q5KP51) Arginine N-methyltransferase 2 (EC 2.1.1.-)| Length = 363 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 131 GLFSCLFSECDDPPFNHSNLEAH 199 G+ LF ECD P +H+ +EAH Sbjct: 189 GIVDRLFQECDPKPSHHTIIEAH 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,860,724 Number of Sequences: 219361 Number of extensions: 1056254 Number of successful extensions: 3855 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3854 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)