| Clone Name | bastl01h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VG28_BPMU (Q9T1W6) Protein gp28 | 30 | 2.6 | 2 | MENF_PASMU (Q9CPI5) Menaquinone-specific isochorismate synthase ... | 28 | 7.6 | 3 | MRS3_YEAST (P10566) Mitochondrial RNA-splicing protein MRS3 | 28 | 7.6 | 4 | DDL_MYCSM (Q9ZGN0) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-a... | 28 | 9.9 |
|---|
>VG28_BPMU (Q9T1W6) Protein gp28| Length = 551 Score = 30.0 bits (66), Expect = 2.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 206 PGREIQIRRFRGSERYSRVTSQSRHGLLQ 292 P R+I + RF + + +T Q RHG++Q Sbjct: 301 PARDIPVLRFEAPDDFESLTPQMRHGIVQ 329
>MENF_PASMU (Q9CPI5) Menaquinone-specific isochorismate synthase (EC 5.4.4.2)| (Isochorismate mutase) Length = 431 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 319 ADQVEWCLWLQQPMARLR 266 ADQ EWC W++Q + +++ Sbjct: 160 ADQAEWCRWVEQGLQKIK 177
>MRS3_YEAST (P10566) Mitochondrial RNA-splicing protein MRS3| Length = 314 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 98 VLKESSFRYSSPEFSMTPVVHCSVGTIS 181 V+ ESS ++ +P P++HC G+IS Sbjct: 202 VIYESSTKFLNPSNEYNPLIHCLCGSIS 229
>DDL_MYCSM (Q9ZGN0) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 373 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 305 FHLISMYKRSWSSANNRLRTLSAAAVETDVA 397 F ISMY R W++ TL AA V+T +A Sbjct: 337 FTTISMYPRMWAAGGIDYPTLLAAMVDTAIA 367 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,252,185 Number of Sequences: 219361 Number of extensions: 966457 Number of successful extensions: 2048 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2048 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)