| Clone Name | bastl01f06 |
|---|---|
| Clone Library Name | barley_pub |
>Y1342_ARATH (Q9C810) PHD finger protein At1g33420| Length = 697 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 245 SWTVDCSCGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNC 388 +W VDC CG DDGE M++CD C VW HTRC + + F C C Sbjct: 601 NWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRC 650
>PHF13_MOUSE (Q8K2W6) PHD finger protein 13| Length = 296 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +2 Query: 239 DGSWT-VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVR-GVHTSFSCHNCR 391 D SW V C C F G M+ C++C W+H CA+ + V F C CR Sbjct: 223 DDSWDLVTCFCMKPFA-GRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCR 274
>PHF13_HUMAN (Q86YI8) PHD finger protein 13| Length = 300 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +2 Query: 239 DGSWT-VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVR-GVHTSFSCHNCR 391 D SW V C C F G M+ C++C W+H CA+ + V F C CR Sbjct: 227 DDSWDLVTCFCMKPFA-GRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCR 278
>LIN59_CAEEL (O44757) Protein lin-59 (Abnormal cell lineage protein 59)| Length = 1312 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYV 352 V C CG ++G MV CD C W+H C +YV Sbjct: 968 VRCICGALDEEGT-MVQCDTCHFWLHVDCCQYV 999
>ATX3_ARATH (Q9M364) Histone-lysine N-methyltransferase ATX3 (EC 2.1.1.43)| (Trithorax-homolog protein 3) (TRX-homolog protein 3) (Protein SET DOMAIN GROUP 14) Length = 902 Score = 35.8 bits (81), Expect = 0.025 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Frame = +2 Query: 281 DDGEEMVSCDDCSVWVHTRC-----ARYVRGVHTSFSCHNCR 391 DDG+ V CD C VWVH C R+ H ++ C +C+ Sbjct: 362 DDGD-WVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDCK 402
>SET3_SCHPO (Q10362) SET domain-containing protein 3| Length = 859 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 248 WTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARY-VRGVHTSFSCHNCR 391 W + C C DDG + C+ C VW H C V + C C+ Sbjct: 2 WKIRCVCPFEDDDGFT-IQCESCEVWQHAVCVNIDANNVPEKYFCEQCQ 49
>PHF16_HUMAN (Q92613) PHD finger protein 16| Length = 823 Score = 34.3 bits (77), Expect = 0.073 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 281 DDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNC 388 ++G +MV CD C+V VH C ++ S+ C +C Sbjct: 212 EEGNDMVFCDKCNVCVHQACYGILKVPEGSWLCRSC 247
>YCHD_SCHPO (Q9Y7V2) Protein C645.13 in chromosome III| Length = 721 Score = 34.3 bits (77), Expect = 0.073 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYV-RGVHTSFSCHNCRHK 397 V C C D G+ V CD C W H C + + S+ C C + Sbjct: 21 VRCVCKSQEDIGDTWVQCDGCDCWQHASCVGLADKDIPESYYCEVCHSR 69
>Y5621_ARATH (O81488) PHD finger protein At5g26210| Length = 255 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +2 Query: 263 SCGVTFDDGEEMVSCDDCSVWVHTRCARY--VRGVH-TSFSCHNCRHK 397 +CG ++ E + CD C +W H +C + R H + C +C +K Sbjct: 204 ACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNK 251
>ATX5_ARATH (Q8GZ42) Histone-lysine N-methyltransferase ATX5 (EC 2.1.1.43)| (Trithorax-homolog protein 5) (TRX-homolog protein 5) (Protein SET DOMAIN GROUP 29) Length = 1043 Score = 33.1 bits (74), Expect = 0.16 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +2 Query: 284 DGEEMVSCDDCSVWVHTRC----ARYVRGV-HTSFSCHNCRHK 397 D + V CD C VW+H+ C ++ + + T + C CR K Sbjct: 427 DSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTCRTK 469
>TRX_DROVI (Q24742) Protein trithorax| Length = 3828 Score = 32.0 bits (71), Expect = 0.36 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = +2 Query: 266 CGVTFDDGE---EMVSCDDCSVWVHTRC 340 C +DD + +M+ C DC+ WVH++C Sbjct: 1414 CQKCYDDNDFDLKMMECGDCNQWVHSKC 1441
>SET4_YEAST (P42948) SET domain protein 4| Length = 560 Score = 32.0 bits (71), Expect = 0.36 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRG--VHTSFSCHNC 388 C CG + E + C+ C W H C + + + F C C Sbjct: 163 CICGSSDSKDELFIQCNKCKTWQHKLCYAFKKSDPIKRDFVCKRC 207
>CTI6_YEAST (Q08923) Transcriptional regulatory protein CTI6| (CYC8-TUP1-interacting protein 6) Length = 506 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/47 (31%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 260 CSCGV--TFDDGEEMVSCDDCSVWVHTRCARYVR-GVHTSFSCHNCR 391 C CG T DD + C+ CS W H C + + C CR Sbjct: 75 CICGELDTPDDSGFFIQCEQCSSWQHGYCVSITQDNAPDKYWCEQCR 121
>TRX_DROME (P20659) Protein trithorax| Length = 3726 Score = 31.2 bits (69), Expect = 0.62 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +2 Query: 266 CGVTFDDGE---EMVSCDDCSVWVHTRC 340 C +DD + +M+ C DC WVH++C Sbjct: 1427 CQRCYDDNDFDLKMMECGDCGQWVHSKC 1454
>DPF3_CHICK (P58270) Zinc-finger protein DPF3 (cer-d4)| Length = 427 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNCR 391 CS T ++ ++++ CDDC H C S+SCH CR Sbjct: 368 CSLCGTSENDDQLLFCDDCDRGYHMYCLNPPVFEPPEGSWSCHLCR 413
>CXCC1_HUMAN (Q9P0U4) CpG-binding protein (PHD finger and CXXC domain-containing| protein 1) (CXXC finger protein 1) Length = 656 Score = 30.8 bits (68), Expect = 0.81 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 296 MVSCDDCSVWVHTRCARYVRGVHTS---FSCHNCRHK 397 M+ CD+C+ W H C R + + + C CR K Sbjct: 40 MIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76
>PHF20_MOUSE (Q8BLG0) PHD finger protein 20 (Hepatocellular carcinoma-associated| antigen 58 homolog) Length = 1010 Score = 30.8 bits (68), Expect = 0.81 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYV-RGVHTSFSCHNCR 391 V C C V ++ + M+ C++C W H C + V ++C+ C+ Sbjct: 656 VRCICEVQ-EENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQ 701
>PHF14_MOUSE (Q9D4H9) PHD finger protein 14| Length = 881 Score = 30.8 bits (68), Expect = 0.81 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 260 CSC-GVTFDDGEEMVSCDDCSVWVHTRC 340 C C G +D +E++ CD+C + VH C Sbjct: 316 CVCLGDNSEDADEIIQCDNCGITVHEGC 343
>CXCC1_MOUSE (Q9CWW7) CpG-binding protein (PHD finger and CXXC domain-containing| protein 1) (CXXC finger protein 1) Length = 660 Score = 30.8 bits (68), Expect = 0.81 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 296 MVSCDDCSVWVHTRCARYVRGVHTS---FSCHNCRHK 397 M+ CD+C+ W H C R + + + C CR K Sbjct: 40 MIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76
>PHF14_HUMAN (O94880) PHD finger protein 14| Length = 888 Score = 30.8 bits (68), Expect = 0.81 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 260 CSC-GVTFDDGEEMVSCDDCSVWVHTRC 340 C C G +D +E++ CD+C + VH C Sbjct: 323 CVCLGDNSEDADEIIQCDNCGITVHEGC 350
>YKA5_YEAST (P36106) Hypothetical 67.9 kDa protein RPL14A-AUR1 intergenic| region Length = 594 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 7/36 (19%) Frame = +2 Query: 254 VDCSCGVT---FDDGE----EMVSCDDCSVWVHTRC 340 V C CG +D E +MV CD C W H +C Sbjct: 73 VRCLCGANNENYDAAEYSHGDMVQCDGCDTWQHIKC 108
>PHF20_HUMAN (Q9BVI0) PHD finger protein 20 (Hepatocellular carcinoma-associated| antigen 58) (Glioma-expressed antigen 2) (Transcription factor TZP) (Novel zinc finger protein) Length = 1012 Score = 30.8 bits (68), Expect = 0.81 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYV-RGVHTSFSCHNCR 391 V C C V ++ + M+ C++C W H C + V ++C+ C+ Sbjct: 653 VRCICEVQ-EENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQ 698
>SPP1_YEAST (Q03012) COMPASS component SPP1 (Complex proteins associated with| SET1 protein SPP1) (Set1C component SPP1) (Suppressor of PRP protein 1) Length = 353 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 281 DDGEEMVSCDDCSVWVHTRC---ARYVRGVHTSFSCHNCR 391 D GE MV CD C W H C + + SF C C+ Sbjct: 31 DYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ 70
>PHF2_MOUSE (Q9WTU0) PHD finger protein 2 (GRC5)| Length = 1096 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C + +D M+ CD C W H C Sbjct: 6 VYCVCRLPYDVTRFMIECDACKDWFHGSC 34
>MES4_DROME (Q8MT36) Probable histone methyltransferase Mes-4 (Maternal-effect| sterile 4) Length = 1427 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 287 GEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNC 388 G E+V C+ C + VH C + S+ C C Sbjct: 1008 GGELVCCETCPIAVHAHCRNIPIKTNESYICEEC 1041
>PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5)| Length = 1101 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C + +D M+ CD C W H C Sbjct: 6 VYCVCRLPYDVTRFMIECDACKDWFHGSC 34
>PHF8_MOUSE (Q80TJ7) PHD finger protein 8| Length = 1023 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C + +D M+ CD C W H C Sbjct: 6 VYCLCRLPYDVTRFMIECDMCQDWFHGSC 34
>PHF8_HUMAN (Q9UPP1) PHD finger protein 8| Length = 1060 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C + +D M+ CD C W H C Sbjct: 42 VYCLCRLPYDVTRFMIECDMCQDWFHGSC 70
>JHD1_ASPFU (Q4WHB7) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1418 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +2 Query: 299 VSCDDCSVWVHTRCA-----RYVRGVHTSFSCHNCR 391 +SCD C W H CA R +R V F C CR Sbjct: 355 ISCDGCKQWFHIVCAGFKNDREIRTV-DKFICRRCR 389
>JHD1_EMENI (Q5AW75) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1407 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 281 DDGEEMVSCDDCSVWVHTRCARYVRGVHT----SFSCHNCR 391 D +SCD C W H CA + T F C CR Sbjct: 340 DQDVTWISCDGCKRWFHIVCAGFKNDRETRTVDKFICKTCR 380
>K1718_HUMAN (Q6ZMT4) Protein KIAA1718| Length = 941 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C +D M+ CD C W H C Sbjct: 38 VYCVCRQPYDVNRFMIECDICKDWFHGSC 66
>SET3_YEAST (P36124) SET domain protein 3| Length = 751 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNC 388 + C C + DDG + CD C+ W H C + + + C++C Sbjct: 118 ITCICDLNDDDGFT-IQCDHCNRWQHAICYGIKDIGMAPDDYLCNSC 163
>DPF1_MOUSE (Q9QX66) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 387 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC-RH 394 CS T ++ ++++ CDDC H C S+SCH C RH Sbjct: 328 CSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRH 375
>K1718_MOUSE (Q3UWM4) Protein KIAA1718| Length = 940 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 254 VDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 V C C +D M+ CD C W H C Sbjct: 38 VYCVCRQPYDVNRFMIECDVCKDWFHGSC 66
>SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component spp1)| (COMPASS component spp1) (Complex proteins associated with set1 protein spp1) Length = 424 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 281 DDGEEMVSCDDCSVWVHTRC 340 DDG M+ CD C W H C Sbjct: 127 DDGSWMLGCDGCEDWFHGTC 146
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 12/56 (21%) Frame = +2 Query: 266 CGVTFDDGE---EMVSCDDCSVWVHTRCARYVRGVH---------TSFSCHNCRHK 397 C +DD + +M+ C C WVH++C ++ +++C NC + Sbjct: 1572 CDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 251 TVDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 TV +CG D G ++ CDDC + HT C Sbjct: 1008 TVCEACGKATDPGR-LLLCDDCDISYHTYC 1036 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 284 DGEEMVSCDDCSVWVHTRCARYV-RGVHTS-FSCHNCR 391 + +M+ CD C HT C + V + V T+ + C NCR Sbjct: 399 EDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCR 436
>JAD1D_MOUSE (Q62240) Jumonji/ARID domain-containing protein 1D (SmcY protein)| (Histocompatibility Y antigen) (H-Y) Length = 1548 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +2 Query: 236 VDGSWTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARY------VRGVHTS 370 ++ S T C CG G E + CD C W H +C VR HTS Sbjct: 1175 MNASATSICICGQVCA-GVESLQCDLCHDWFHGQCVTVPHLLSSVRASHTS 1224
>ATL3D_ARATH (Q9SRM0) Probable RING-H2 finger protein ATL3D| Length = 158 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNCR 391 C C F++GE+M CS H C R + T SC CR Sbjct: 108 CICLGGFEEGEKMKVLPPCSHCYHCECVD--RWLKTESSCPLCR 149
>TCF19_PANTR (Q7YR48) Transcription factor 19 (Transcription factor SC1)| Length = 345 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNCR 391 C + ++ V CD C VW H C F C CR Sbjct: 297 CCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCR 340
>TCF19_MACMU (Q5TM48) Transcription factor 19| Length = 345 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNCR 391 C + ++ V CD C VW H C F C CR Sbjct: 297 CCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCR 340
>TCF19_HUMAN (Q9Y242) Transcription factor 19 (Transcription factor SC1)| Length = 345 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNCR 391 C + ++ V CD C VW H C F C CR Sbjct: 297 CCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCR 340
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 251 TVDCSCGVTFDDGEEMVSCDDCSVWVHTRC 340 TV +CG D G ++ CDDC + HT C Sbjct: 1001 TVCEACGKATDPGR-LLLCDDCDISYHTYC 1029 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 284 DGEEMVSCDDCSVWVHTRCARYV-RGVHTS-FSCHNCR 391 + +M+ CD C HT C + V + V T+ + C NCR Sbjct: 398 EDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCR 435
>GCH2_YEAST (P38066) GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II)| Length = 345 Score = 28.9 bits (63), Expect = 3.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 239 DGSWTVDCSCGVTFDDGEEMVSCD 310 + +W+ C CG FD +++CD Sbjct: 152 ENAWSARCDCGEQFDRAGRLIACD 175
>MSC1_SCHPO (Q9UT79) Multicopy suppressor of chk1 protein 1| Length = 1588 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +2 Query: 239 DGSWTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNC 388 D + +V C C F + V C +C W H C + ++ S + C Sbjct: 1450 DQNASVICLCRQPFAISDGTVQCHNCLEWFHYECVGLSSDIVSTLSNYAC 1499
>FBLN1_MOUSE (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90)| Length = 705 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNCR 391 CSC F + SC+D + +++ C++ V+ S+ C+ CR Sbjct: 426 CSCSAGFRLSVDGRSCEDVNECLNSPCSQECANVYGSYQCY-CR 468
>TF7L2_MOUSE (Q924A0) Transcription factor 7-like 2 (HMG box transcription| factor 4) (T-cell-specific transcription factor 4) (TCF-4) (mTCF-4) Length = 459 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +1 Query: 10 FPPYCVPPEHSLVHASSSP----FHPNEQRKSGEPDLG 111 FPP+ VPP H+L H + P P +++S + D+G Sbjct: 270 FPPHMVPPHHTL-HTTGIPHPAIVTPTVKQESSQSDVG 306
>FBLN1_CERAE (Q8MJJ9) Fibulin-1 (Fragment)| Length = 598 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNCR 391 CSC V F + SC+D + + C++ V+ S+ C+ CR Sbjct: 339 CSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCY-CR 381
>TF7L2_HUMAN (Q9NQB0) Transcription factor 7-like 2 (HMG box transcription| factor 4) (T-cell-specific transcription factor 4) (TCF-4) (hTCF-4) Length = 619 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +1 Query: 10 FPPYCVPPEHSLVHASSSP----FHPNEQRKSGEPDLG 111 FPP+ VPP H+L H + P P +++S + D+G Sbjct: 293 FPPHMVPPHHTL-HTTGIPHPAIVTPTVKQESSQSDVG 329
>PHF15_HUMAN (Q9NQC1) PHD finger protein 15| Length = 576 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 296 MVSCDDCSVWVHTRCARYVRGVHTSFSCHNC 388 MV CD C+V VH C ++ S+ C C Sbjct: 1 MVFCDKCNVCVHQACYGILKVPTGSWLCRTC 31
>FBLN1_HUMAN (P23142) Fibulin-1 precursor| Length = 703 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHNCR 391 CSC V F + SC+D + + C++ V+ S+ C+ CR Sbjct: 424 CSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCY-CR 466
>OLEE1_BETVE (O49813) Olee1-like protein precursor| Length = 166 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 290 EEMVSCDDCSVWVHTRCARYVRGVHTSFSCHN 385 E V CD+C T+ + Y++G S C N Sbjct: 30 EGKVYCDNCRTQFVTKLSTYMKGAKVSLECRN 61
>HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment)| Length = 3866 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = +2 Query: 266 CGVTFDDGE---EMVSCDDCSVWVHTRC 340 C +DD + +M+ C C WVH++C Sbjct: 1471 CDKCYDDDDYESKMMQCGKCDRWVHSKC 1498
>DPF1_CHICK (P58267) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 380 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 257 DCSCGVTFDDGEEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC 388 +CS + ++ E+++ CDDC H C ++SCH C Sbjct: 320 NCSLCGSAENDEQLLFCDDCDRGYHMYCISPPVAEPPEGTWSCHLC 365
>DPF1_HUMAN (Q92782) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 353 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = +2 Query: 260 CS-CGVTFDDG---------EEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC-RH 394 CS CG + +DG ++++ CDDC H C S+SCH C RH Sbjct: 284 CSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRH 341
>JHD1_YARLI (Q6C423) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 510 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 284 DGEEMVSCDDCSVWVHTRCARYVRGV-HTSFSCHNC 388 D ++ CD C WVH C V + + C C Sbjct: 15 DKQQWTQCDGCDRWVHDVCVSITDPVSYAKYHCPTC 50
>DPF1_RAT (P56163) Zinc-finger protein neuro-d4 (D4, zinc and double PHD| fingers family 1) Length = 397 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = +2 Query: 260 CS-CGVTFDDG---------EEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC-RH 394 CS CG + +DG ++++ CDDC H C S+SCH C RH Sbjct: 328 CSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRH 385
>REQUB_XENLA (Q9W636) Zinc-finger protein ubi-d4 B (Requiem B) (xReq B)| (Apoptosis response zinc finger protein B) (Fragment) Length = 366 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC 388 CG + +D ++++ CDDC H C S+SCH C Sbjct: 310 CGTSEND-DQLLFCDDCDRGYHMYCLSPPVAEPPEGSWSCHLC 351
>TCF19_PIG (Q9TSV4) Transcription factor 19 (Transcription factor SC1)| Length = 346 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/44 (27%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNCR 391 C + ++ V CD C W H C F C CR Sbjct: 298 CCLPQEETVAWVQCDGCDTWFHVACVGCSIQAAKEADFRCPGCR 341
>REQUA_XENLA (Q9W638) Zinc-finger protein ubi-d4 A (Requiem A) (xReq A)| (Apoptosis response zinc finger protein A) Length = 388 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNC 388 CG + +D ++++ CDDC H C S+SCH C Sbjct: 332 CGTSEND-DQLLFCDDCDRGYHMYCLVPPVAEPPEGSWSCHLC 373
>RNF31_MOUSE (Q924T7) RING finger protein 31| Length = 1066 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = +2 Query: 248 WTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHN 385 W CS G ++ + +C C RC R H SC + Sbjct: 792 WCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCED 837
>RNF31_HUMAN (Q96EP0) RING finger protein 31 (Zinc in-between-RING-finger| ubiquitin-associated domain protein) Length = 1072 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = +2 Query: 248 WTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVRGVHTSFSCHN 385 W CS G ++ + +C C RC R H SC + Sbjct: 798 WCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCED 843
>JHD1_YEAST (P40034) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) (ScJHDM1) Length = 492 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 299 VSCDDCSVWVHTRCARYVRGVHTS 370 V CD C WVH +C R +H S Sbjct: 22 VKCDSCPQWVHVKCVPLKR-IHYS 44
>SMAD1_COTJA (Q9I962) Mothers against decapentaplegic homolog 1 (SMAD 1)| (Mothers against DPP homolog 1) (Mad-related protein 1) Length = 465 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 13 PPYCVPPEHSLVHASSSPFHPNEQRKSGEPDL 108 PP +PPE + H +S P N PD+ Sbjct: 224 PPAYLPPEDQMTHDTSQPMDTNMMAPGIHPDI 255
>PCL_DROME (Q24459) Polycomb protein Pcl (Polycomblike protein)| Length = 1043 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 Query: 260 CSCGVTFDDGEEMVSCDDCSVWVHTRC 340 C CG M+ C C W HT+C Sbjct: 515 CYCGKPGKFDHNMLQCCKCRNWFHTQC 541
>ZN687_HUMAN (Q8N1G0) Zinc finger protein 687| Length = 1237 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 13 PPYCVPPEHSLVHASSSPFHPNEQRKSGEPDLGFSPLAAD 132 PP PP +L S SP HP + G G SP A D Sbjct: 211 PPVSSPPLGALKQESCSPHHPQVLAQQGS---GSSPKATD 247
>JAD1C_HUMAN (P41229) Jumonji/ARID domain-containing protein 1C (SmcX protein)| (Xe169 protein) Length = 1560 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 245 SWTVDCSCGVTFDDGEEMVSCDDCSVWVHTRCARYVR 355 S T C CG G + CD C W H RC R Sbjct: 1183 STTSICVCGQVLA-GAGRLQCDLCQDWFHGRCVSVPR 1218
>REQU_MOUSE (Q61103) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) (D4, zinc and double PHD fingers family 2) Length = 391 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNC 388 CG + +D ++++ CDDC H C S+SCH C Sbjct: 333 CGTSEND-DQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLC 374
>REQU_HUMAN (Q92785) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) (D4, zinc and double PHD fingers family 2) Length = 391 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRC--ARYVRGVHTSFSCHNC 388 CG + +D ++++ CDDC H C S+SCH C Sbjct: 333 CGTSEND-DQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLC 374
>LY10_HUMAN (Q13342) Nuclear body protein SP140 (Nuclear autoantigen Sp-140)| (Speckled 140 kDa) (LYSp100 protein) (Lymphoid-restricted homolog of Sp100) Length = 882 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 284 DGEEMVSCDDCSVWVHTRC-ARYVRGVHTSFSCHNCRHK 397 DG E+ CD CS H C V T ++C CR K Sbjct: 698 DGGELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMK 736
>REQU_CHICK (P58268) Zinc-finger protein ubi-d4 (Requiem) (Apoptosis response| zinc finger protein) Length = 405 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 266 CGVTFDDGEEMVSCDDCSVWVHTRCAR--YVRGVHTSFSCHNC 388 CG + +D ++++ CDDC H C S+SCH C Sbjct: 347 CGTSEND-DQLLFCDDCDRGYHMYCLTPPMSEPPEGSWSCHLC 388
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 397 LVPAVVAGEGGVHAPDVARA 338 L P V AGEGG+HA + RA Sbjct: 610 LGPGVQAGEGGLHAGEAGRA 629
>KPC1_YEAST (P24583) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1)| Length = 1151 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/32 (34%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 260 CSCGVTFDDGEEMV-SCDDCSVWVHTRCARYV 352 C CG G V C +C + H +CA V Sbjct: 496 CHCGYILPWGRHKVRKCSECGIMCHAQCAHLV 527 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.135 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,061,660 Number of Sequences: 219361 Number of extensions: 459538 Number of successful extensions: 1646 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 1552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1646 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)