| Clone Name | bastl01f01 |
|---|---|
| Clone Library Name | barley_pub |
>I20L2_HUMAN (Q9H9L3) Interferon-stimulated 20 kDa exonuclease-like 2 (EC| 3.1.-.-) Length = 353 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 267 FRRKSTTATDHGTSRPLAKTKSIELSKPSPDKKSGS 374 F +K T A+ +G+ +PL K ++ P+P KK+ S Sbjct: 76 FPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADS 111
>GLT11_DROME (Q8IA41) Putative polypeptide N-acetylgalactosaminyltransferase 11| (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase 11) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11) (pp-GaNTase 11) Length = 557 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -3 Query: 375 YFHSSCQGRVCLVQYFLFWQVGDWYHGLWQLCSFYGSRSQVIGSETELS-KIWRMG 211 Y S +GRV + FW +G W GL YG G ELS K+W+ G Sbjct: 272 YPSSQLEGRVFAIDRKWFWHLGGWDEGLRD----YG------GDALELSLKVWQCG 317
>CY551_CHLTE (O07091) Cytochrome C (Photosystem P840 reaction center cytochrome| c-551) Length = 206 Score = 28.9 bits (63), Expect = 3.1 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +3 Query: 204 INFPFAISLIVLFRYLSLDYDFRRKSTTATDHGTSRPLAKTKSIELSKPS 353 ++FP +I +IV+ +LSL + + TT D R A+ K L+KP+ Sbjct: 79 LSFPLSIFVIVMVMFLSLRVYWEKGRTTTVDGKYIRTTAELKEF-LNKPA 127
>CCDC_BACSU (P45710) Protein ccdC| Length = 160 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 349 GLLSSILFVLASGRLVPWSVAVVL 278 G LS + ++LA G +VPW +A+ L Sbjct: 120 GALSGMFWILAFGMIVPWRIAMYL 143
>Y236_RHIME (Q92SW6) UPF0090 protein R00236| Length = 205 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 223 MANGKLILTEELVRDMRKASPKAK 152 ++ +LILT+EL+RD A KAK Sbjct: 165 LSEARLILTDELIRDALTADKKAK 188
>TMPS9_RAT (P69526) Transmembrane protease, serine 9 (EC 3.4.21.-)| (Polyserase-1) (Polyserine protease 1) (Polyserase-I) [Contains: Serase-1; Serase-2; Serase-3] Length = 1061 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 190 LVRDMRKASPKAKTRSSTARFFPSSARSRTVCAALGAPPG 71 + R ++KA+ + + + RF+P SR +CA G P G Sbjct: 965 MARQLQKAAVRVLSEQTCRRFYPVQISSRMLCA--GFPQG 1002
>TMPS9_MOUSE (P69525) Transmembrane protease, serine 9 (EC 3.4.21.-)| (Polyserase-1) (Polyserine protease 1) (Polyserase-I) [Contains: Serase-1; Serase-2; Serase-3] Length = 1065 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 190 LVRDMRKASPKAKTRSSTARFFPSSARSRTVCAALGAPPG 71 + R ++KA+ + + + RF+P SR +CA G P G Sbjct: 969 MARQLQKAAVRVLSEQTCRRFYPVQISSRMLCA--GFPQG 1006
>TMPS9_HUMAN (Q7Z410) Transmembrane protease, serine 9 (EC 3.4.21.-)| (Polyserase-1) (Polyserase-I) (Polyserine protease 1) [Contains: Serase-1; Serase-2; Serase-3] Length = 1059 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 190 LVRDMRKASPKAKTRSSTARFFPSSARSRTVCAALGAPPG 71 + R ++KA+ + + + RF+P SR +CA G P G Sbjct: 963 MARQLQKAAVRLLSEQTCRRFYPVQISSRMLCA--GFPQG 1000
>LMBR1_MOUSE (Q9JIT0) Limb region 1 protein| Length = 490 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 333 YFLFWQVGDWYHGLWQLCSFYGS 265 Y++ W G HGLW L S + + Sbjct: 95 YYIQWLNGSLIHGLWNLASLFSN 117
>LMBR1_HUMAN (Q8WVP7) Limb region 1 protein homolog (Differentiation-related| gene 14 protein) Length = 490 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 333 YFLFWQVGDWYHGLWQLCSFYGS 265 Y++ W G HGLW L S + + Sbjct: 95 YYIQWLNGSLIHGLWNLASLFSN 117
>Y090_AGRT5 (Q8UJ48) UPF0090 protein Atu0090/AGR_C_138| Length = 198 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -2 Query: 223 MANGKLILTEELVRDMRKASPKAKTRSS 140 +++ KLILT++L+RD +A AK ++ Sbjct: 160 LSDAKLILTDDLIRDALRADKAAKAAAA 187
>MIP_LEGLO (P53605) Outer membrane protein MIP precursor (Macrophage| infectivity potentiator) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPIase) (Rotamase) Length = 233 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -2 Query: 223 MANGKLILTEELVRDMRKASPKAKTRSSTARF----FPSSARSRTVCAALGAPPGVAILP 56 M+ +LILTEE ++D+ K +A F + A+ +A + PG+ +LP Sbjct: 66 MSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLP 125
>LMBR1_CHICK (Q7ZUA6) Limb region 1 protein homolog| Length = 488 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 333 YFLFWQVGDWYHGLWQLCSFYGS 265 Y++ W G HGLW L S + + Sbjct: 94 YYIQWLNGSLIHGLWNLASLFSN 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,810,282 Number of Sequences: 219361 Number of extensions: 646104 Number of successful extensions: 2045 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2043 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)