Clone Name | bastl01d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3) | 38 | 0.006 | 2 | NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5) | 38 | 0.006 | 3 | NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2) | 38 | 0.006 |
---|
>NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3)| Length = 1222 Score = 38.1 bits (87), Expect = 0.006 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPNGYY 277 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN Y Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGY 77
>NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5)| Length = 1222 Score = 38.1 bits (87), Expect = 0.006 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPNGYY 277 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN Y Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGY 77
>NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2)| Length = 1267 Score = 38.1 bits (87), Expect = 0.006 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPNGYY 277 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN Y Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGY 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,851,954 Number of Sequences: 219361 Number of extensions: 316788 Number of successful extensions: 679 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)