Clone Name | bastl01c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CN032_MOUSE (Q8BH93) Protein C14orf32 homolog | 32 | 0.93 | 2 | BDBB_BPSPC (P68572) Disulfide bond formation protein B (Disulfid... | 29 | 7.8 | 3 | BDBB_BACSU (P68571) SPBc2 prophage-derived disulfide bond format... | 29 | 7.8 | 4 | UL14_HHV11 (P04291) Hypothetical UL14 protein | 29 | 7.8 |
---|
>CN032_MOUSE (Q8BH93) Protein C14orf32 homolog| Length = 242 Score = 32.0 bits (71), Expect = 0.93 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 202 PSPSPWEAPASDPEMASGLADSSDDPS 122 P SPW P++ P M SGL SS PS Sbjct: 35 PGSSPWSNPSAPPAMPSGLPPSSAAPS 61
>BDBB_BPSPC (P68572) Disulfide bond formation protein B (Disulfide| oxidoreductase B) (Thiol-disulfide oxidoreductase B) Length = 148 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 301 RMLFPLVFFSQIMITTSQIH*SKLRHFKLSFCGWYTGLDCLPVPM 435 + F L+FF T + + S++ HFK WY + P+P+ Sbjct: 7 KSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPI 51
>BDBB_BACSU (P68571) SPBc2 prophage-derived disulfide bond formation protein B| (Disulfide oxidoreductase B) (Thiol-disulfide oxidoreductase B) Length = 148 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 301 RMLFPLVFFSQIMITTSQIH*SKLRHFKLSFCGWYTGLDCLPVPM 435 + F L+FF T + + S++ HFK WY + P+P+ Sbjct: 7 KSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPI 51
>UL14_HHV11 (P04291) Hypothetical UL14 protein| Length = 219 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 202 PSPSPWEAPASDPEMASGLADSSDD 128 PSP+P PA+DP ASG A D Sbjct: 193 PSPAPPTGPATDPASASGFARDYPD 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,665,198 Number of Sequences: 219361 Number of extensions: 1059640 Number of successful extensions: 3679 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3670 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)