Clone Name | bastl01b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLNA_SULAC (Q9HH09) Glutamine synthetase (EC 6.3.1.2) (Glutamate... | 29 | 3.9 | 2 | CF015_MACMU (Q9BGL9) Protein C6orf15 homolog precursor (rmSTG) | 28 | 6.7 | 3 | CF015_HUMAN (Q6UXA7) Protein C6orf15 precursor (STG protein) | 28 | 8.8 | 4 | DBP4_KLULA (Q6CRF4) ATP-dependent RNA helicase DBP4 (EC 3.6.1.-) | 28 | 8.8 |
---|
>GLNA_SULAC (Q9HH09) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 473 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 86 GRRRRLDQGDPANQPTYPMAGKKRPPTVLAEL 181 G RR+LD GDP ++ Y M+ +K+ + EL Sbjct: 386 GIRRKLDPGDPVDENIYHMSEEKKRSLKIREL 417
>CF015_MACMU (Q9BGL9) Protein C6orf15 homolog precursor (rmSTG)| Length = 314 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 161 VASSCRPLDRLVGSLGLPGRAAAVCRGLCSIRDETRRD-ETGRPSLGEPRPT 9 VA SC PL L+ L LPG A R + ++ ++ ++ T P LG+P T Sbjct: 5 VAGSCAPLGLLLVCLRLPGLFA---RSIGAVEEKVSQNLGTNLPQLGQPSLT 53
>CF015_HUMAN (Q6UXA7) Protein C6orf15 precursor (STG protein)| Length = 325 Score = 28.1 bits (61), Expect = 8.8 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 161 VASSCRPLDRLVGSLGLPGRAAAVCRGLCSIRDETRRD-ETGRPSLGEPRPT 9 VA SC PL L+ L LPG A R + + ++ ++ T P LG+P T Sbjct: 5 VAGSCAPLGLLLVCLHLPGLFA---RSIGVVEEKVSQNLGTNLPQLGQPSST 53
>DBP4_KLULA (Q6CRF4) ATP-dependent RNA helicase DBP4 (EC 3.6.1.-)| Length = 770 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -3 Query: 143 PLDRLVGSLGLPGRAAAVCRGLCSIRDETRRDETGRPSL 27 PL++ SLGLPG RG+ SI T R L Sbjct: 471 PLEQFANSLGLPGAPKIKMRGMKSIEKAKELKNTSRQLL 509 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.127 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,578,556 Number of Sequences: 219361 Number of extensions: 390577 Number of successful extensions: 1151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)