| Clone Name | bart61f06 |
|---|---|
| Clone Library Name | barley_pub |
>TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I) (TNKS-1)| (TRF1-interacting ankyrin-related ADP-ribose polymerase) Length = 1327 Score = 32.3 bits (72), Expect = 0.59 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 299 HHQHHFQQSNRSCSGRRLPPHAPPP 225 HH HH QQ + G PP PPP Sbjct: 9 HHHHHHQQQLQPAPGASAPPPPPPP 33
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 2 SSCPTRPPIPPKCRSKNISLAPPPP 76 SS P+ PP PP S + S+APPPP Sbjct: 352 SSAPSGPPPPPPPLSVSGSVAPPPP 376
>PO3F3_MOUSE (P31361) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 495 Score = 29.6 bits (65), Expect = 3.8 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 281 ENGAGGEAAPLHALGVLLLHQGPPQRGRAVPRLPPHELEP 400 + GAG E LHA G L H+GPP G P PPH+ P Sbjct: 147 KGGAGRE--DLHA-GTALHHRGPPHLGPPPP--PPHQGHP 181
>NIFA_AZOBR (P30667) Nif-specific regulatory protein| Length = 625 Score = 29.3 bits (64), Expect = 5.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 8 CPTRPPIPPKCRSKNISLAPPP 73 CP+R P+PP+ + + APPP Sbjct: 547 CPSRAPLPPQAPPPSPAAAPPP 568
>RT36_MOUSE (Q9CQX8) Mitochondrial 28S ribosomal protein S36 (S36mt) (MRP-S36)| Length = 102 Score = 29.3 bits (64), Expect = 5.0 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Frame = +2 Query: 257 RCRSDLTAENGAGGEAAPLHALGV-----------LLLHQGPPQRGRAVPRLP 382 R + L+A G A P H+ + LL+HQGPP + LP Sbjct: 28 RDKPKLSASEALGSAALPSHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLP 80
>EID1_ARATH (Q8LEA8) Phytochrome A-associated F-box protein (Empfindlicher im| dunkelroten Licht protein 1) Length = 336 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 351 LSEDALFLVFRHMNWNPRLIAHLSCVCKWFDEVAK 455 + ED +F +F + +PR A L+CVC F + + Sbjct: 9 IPEDVVFNIFFKLQDDPRNWARLACVCTKFSSIVR 43
>AKP8L_HUMAN (Q9ULX6) A-kinase anchor protein 8-like (AKAP8-like protein)| (Neighbor of A-kinase anchoring protein 95) (Neighbor of AKAP95) (Homologous to AKAP95 protein) (HA95) (Helicase A-binding protein 95) (HAP95) Length = 646 Score = 28.5 bits (62), Expect = 8.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 11 PTRPPIPPKCRSKNISLAPPPP 76 P +PP+PP+ +S PPPP Sbjct: 586 PAQPPVPPEPAPGAVSPPPPPP 607
>LCE4A_HUMAN (Q5TA78) Late cornified envelope protein 4A (Late envelope| protein 8) (Small proline-rich-like epidermal differentiation complex protein 4A) Length = 99 Score = 28.5 bits (62), Expect = 8.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 8 CPTRPPIPPKCRSKNISLAPPP 73 CP P PPKC SK S PPP Sbjct: 16 CPI-PKYPPKCPSKCASSCPPP 36
>PO3F3_HUMAN (P20264) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 500 Score = 28.5 bits (62), Expect = 8.6 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +2 Query: 281 ENGAGGEAAPLHALGVLLLHQGPPQRGRAVPRLPPHELEP 400 + GAG + LHA G L H+GPP G P PPH+ P Sbjct: 150 KGGAGRD--DLHA-GTALHHRGPPHLGPPPP--PPHQGHP 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,956,472 Number of Sequences: 219361 Number of extensions: 708504 Number of successful extensions: 3826 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3762 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)