Clone Name | bart60a03 |
---|---|
Clone Library Name | barley_pub |
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 62.4 bits (150), Expect = 5e-10 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 309 IFNFGDSNSDTGGMAAASGLNIALPEGRTYFRRPTGRLSDGRLVIDF 449 IFNFGDSNSDTGG AAA + P G T+F R TGR SDGRL+IDF Sbjct: 35 IFNFGDSNSDTGGKAAAF-YPLNPPYGETFFHRSTGRYSDGRLIIDF 80
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 60.8 bits (146), Expect = 1e-09 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +3 Query: 309 IFNFGDSNSDTGGMAAASGLNIALPEGRTYFRRPTGRLSDGRLVIDF 449 IFNFGDSNSDTGG++AA G P G ++F P GR DGRLVIDF Sbjct: 31 IFNFGDSNSDTGGLSAAFG-QAGPPHGSSFFGSPAGRYCDGRLVIDF 76
>PARC_HUMAN (Q8IWT3) p53-associated parkin-like cytoplasmic protein| (UbcH7-associated protein 1) Length = 2517 Score = 29.6 bits (65), Expect = 3.6 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +1 Query: 118 RSACGCSTTCCWRGWARC--CSSP 183 R GC TTC GWA C CS P Sbjct: 2172 RQGLGCGTTCSKCGWASCFNCSFP 2195
>FAS_RAT (P12785) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-ca Length = 2505 Score = 29.6 bits (65), Expect = 3.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 146 HVVLQPQADLGPAPAPSAVHP 84 HV+LQP PAPAP A P Sbjct: 401 HVILQPNTQQAPAPAPHAALP 421
>BGBP1_DROME (Q9NHB0) Gram-negative bacteria-binding protein 1 precursor| Length = 494 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = +3 Query: 258 VATRAGEPEGRKRSPVVIFN-----FGDSNSDTGGMAAASGLNIALPEGRTYFRRPTGRL 422 + RA P+G P+++ +G S ++G L +AL G + R P G+L Sbjct: 289 IEIRAKLPKGDWIVPLLLLEPLTEWYGQSGYESGQ------LRVALARGNSVLRMPRGKL 342 Query: 423 SDGR 434 DGR Sbjct: 343 VDGR 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,175,228 Number of Sequences: 219361 Number of extensions: 449458 Number of successful extensions: 2069 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2067 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)