Clone Name | bart58b12 |
---|---|
Clone Library Name | barley_pub |
>HCFC1_MOUSE (Q61191) Host cell factor (HCF) (HCF-1) (C1 factor) [Contains: HCF| N-terminal chain 1; HCF N-terminal chain 2; HCF N-terminal chain 3; HCF N-terminal chain 4; HCF N-terminal chain 5; HCF N-terminal chain 6; HCF C-terminal chain 1; HCF C-termi Length = 2045 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 55 QPSQRRMVGWTQPLPRQLH 111 QP +R+VGW+ P+PR H Sbjct: 16 QPRWKRVVGWSGPVPRPRH 34
>ASPX_HUMAN (P26436) Acrosomal protein SP-10 precursor (Acrosomal vesicle| protein 1) Length = 265 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 4 GRPFPRNHPEGHHTDGQQPSQRRMVG 81 G P H EG HT G+QPS + G Sbjct: 96 GEPAATEHAEGEHTVGEQPSGEQPSG 121
>HCFC1_HUMAN (P51610) Host cell factor (HCF) (HCF-1) (C1 factor) (VP16 accessory| protein) (VCAF) (CFF) [Contains: HCF N-terminal chain 1; HCF N-terminal chain 2; HCF N-terminal chain 3; HCF N-terminal chain 4; HCF N-terminal chain 5; HCF N-terminal chain Length = 2035 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 55 QPSQRRMVGWTQPLPRQLH 111 QP +R+VGW+ P+PR H Sbjct: 16 QPRWKRVVGWSGPVPRPRH 34
>HCFC1_MESAU (P51611) Host cell factor (HCF) (HCF-1) (C1 factor) (VP16 accessory| protein) (VCAF) [Contains: HCF N-terminal chain 1; HCF N-terminal chain 2; HCF N-terminal chain 3; HCF N-terminal chain 4; HCF N-terminal chain 5; HCF N-terminal chain 6; HCF Length = 2090 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 55 QPSQRRMVGWTQPLPRQLH 111 QP +R+VGW+ P+PR H Sbjct: 16 QPRWKRVVGWSGPVPRPRH 34
>RLUD_BUCAI (P57481) Ribosomal large subunit pseudouridine synthase D (EC| 5.4.99.-) (rRNA-uridine isomerase D) (rRNA pseudouridylate synthase D) Length = 312 Score = 28.5 bits (62), Expect = 5.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 13 FPRNHPEGHHTDGQQPSQRRMVGWTQPLPRQL 108 FPR +H P ++ ++ WT PLP+ + Sbjct: 274 FPRQALHANHLSLHHPIKKNVMSWTVPLPQDI 305
>ASPX_PAPHA (Q06990) Acrosomal protein SP-10 precursor (Acrosomal vesicle| protein 1) Length = 285 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 4 GRPFPRNHPEGHHTDGQQPSQRRMVG 81 G P H EG HT G+QPS + G Sbjct: 96 GEPAATGHAEGEHTVGEQPSGEQPSG 121
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 27.7 bits (60), Expect = 9.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 38 IIQTVNNHPNAGWSA 82 II +N HPNAGW A Sbjct: 33 IISYINEHPNAGWRA 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,926,523 Number of Sequences: 219361 Number of extensions: 448019 Number of successful extensions: 1190 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)