Clone Name | bart55h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | K1279_HUMAN (Q96EK5) Protein KIAA1279 | 32 | 1.6 | 2 | GP156_HUMAN (Q8NFN8) Probable G-protein coupled receptor 156 (GA... | 31 | 2.7 |
---|
>K1279_HUMAN (Q96EK5) Protein KIAA1279| Length = 621 Score = 31.6 bits (70), Expect = 1.6 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 6/92 (6%) Frame = -1 Query: 260 RKPYDCSHSSAAAVAGEEELRRMAAEDRGDARMEEDG------VAGMPSEMRRP*AATAR 99 ++PY +S+ A + + L A ED + EDG G+P+E+ P A+ Sbjct: 30 KEPYKSKYSARALLEEVKALLGPAPEDEDERPEAEDGPGAGDHALGLPAEVVEPEGPVAQ 89 Query: 98 REMRKGTSGKERRCRRIAIATEEVGAGRRALV 3 R +R E I TEE+ AG LV Sbjct: 90 RAVRLAVI--EFHLGVNHIDTEELSAGEEHLV 119
>GP156_HUMAN (Q8NFN8) Probable G-protein coupled receptor 156 (GABAB-related| G-protein coupled receptor) (G-protein coupled receptor PGR28) Length = 814 Score = 30.8 bits (68), Expect = 2.7 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 258 PSVHHHRVRKHVPGAHLRLPHVQGGHVP 341 PS HR + VPGAH RL HVQ G P Sbjct: 617 PSSVGHRANRTVPGAHSRL-HVQNGDSP 643 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,958,187 Number of Sequences: 219361 Number of extensions: 741569 Number of successful extensions: 2879 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2875 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)