| Clone Name | bart55b05 |
|---|---|
| Clone Library Name | barley_pub |
>CCR5_CERTO (O62743) C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5)| (CCR-5) (CCR5) (CD195 antigen) Length = 352 Score = 30.4 bits (67), Expect = 2.8 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 4 WVVFGIAPFTSLPGVLLRLSAHLGVVLACPPHSP 105 WVV A F SLPG++ S G+ C PH P Sbjct: 153 WVV---AVFASLPGIIFTRSQREGLHYTCSPHFP 183
>TRPM7_MOUSE (Q923J1) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) (Transient receptor potential-phospholipase C-interacting kinase) (TRP-PLIK) Length = 1863 Score = 29.3 bits (64), Expect = 6.3 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 7/46 (15%) Frame = -2 Query: 159 PSPVSPPELRP-------VLVFMDRRRMGRAGEHHPEMS*EPEKHS 43 PS VSPPELR + +F +++G + P MS P K S Sbjct: 1356 PSAVSPPELRQRRHGVEMLKIFNKNQKLGSSPNSSPHMSSPPTKFS 1401
>CCR5_CALMO (Q95NC2) C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5)| (CCR-5) (CCR5) (CD195 antigen) Length = 352 Score = 29.3 bits (64), Expect = 6.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 4 WVVFGIAPFTSLPGVLLRLSAHLGVVLACPPHSP 105 WVV A F SLPG++ S G C PH P Sbjct: 153 WVV---AVFASLPGIIFTRSQKEGYHYTCSPHFP 183
>CCR5_ATEGE (Q95NC4) C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5)| (CCR-5) (CCR5) (CD195 antigen) Length = 352 Score = 29.3 bits (64), Expect = 6.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 4 WVVFGIAPFTSLPGVLLRLSAHLGVVLACPPHSP 105 WVV A F SLPG++ S G C PH P Sbjct: 153 WVV---AVFASLPGIIFTRSQKEGYHYTCSPHFP 183
>CCR5_ALOSE (Q95NC9) C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5)| (CCR-5) (CCR5) (CD195 antigen) Length = 352 Score = 29.3 bits (64), Expect = 6.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 4 WVVFGIAPFTSLPGVLLRLSAHLGVVLACPPHSP 105 WVV A F SLPG++ S G C PH P Sbjct: 153 WVV---AVFASLPGIIFTRSQKEGYHYTCSPHFP 183
>OXAA_SHEON (Q8EKT6) Inner membrane protein oxaA| Length = 541 Score = 29.3 bits (64), Expect = 6.3 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +2 Query: 329 ILVVSALCVAFYVLGAWQNTTMPNPVS--DSAISRVDCD---PVARRDSSVPSFASASEN 493 IL++ L V+F + WQ P PV+ S ++ + V D+ VP+ +A++N Sbjct: 7 ILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTGVPAAVAATQN 66 Query: 494 VL 499 ++ Sbjct: 67 LI 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,488,312 Number of Sequences: 219361 Number of extensions: 1517296 Number of successful extensions: 4894 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4893 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)