Clone Name | bart54e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-ass... | 30 | 3.6 | 2 | KPTA_AERPE (Q9YFP5) Probable RNA 2'-phosphotransferase (EC 2.7.-.-) | 30 | 4.7 | 3 | CP27B_HUMAN (O15528) 25-hydroxyvitamin D-1 alpha hydroxylase, mi... | 29 | 8.0 |
---|
>RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1857 Score = 30.4 bits (67), Expect = 3.6 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = -2 Query: 312 HAPIRTSRLGPPRPRGGIAAWQEQVTARARGRRANLGPLLRQGRCGRLSGG 160 + P + RLGP R RGG+ + T R LGP R R L G Sbjct: 1435 NGPQASGRLGPTRERGGLPVIEGPRTGLEASGRGRLGPSRRCSRGRALEPG 1485
>KPTA_AERPE (Q9YFP5) Probable RNA 2'-phosphotransferase (EC 2.7.-.-)| Length = 220 Score = 30.0 bits (66), Expect = 4.7 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 520 QPMNILEHNPSEE*RPLLAKQRQL-GRRLRAHLPPYLGSLPS*VDRHGS 377 +P IL H +EE PL+ ++ + GRRL+ HL L S RHG+ Sbjct: 123 EPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGN 171
>CP27B_HUMAN (O15528) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial| precursor (EC 1.14.13.13) (Cytochrome P450 subfamily XXVIIB polypeptide 1) (Cytochrome p450 27B1) (Calcidiol 1-monooxygenase) (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D(3) Length = 508 Score = 29.3 bits (64), Expect = 8.0 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +3 Query: 153 TECRHSASRISPAGGADPN-WRVSLWLAPSPAPAKRRSLPADAAGRGVMCGSEHGRDRLA 329 T C ++ SR PA +PN +R + WL P P SLP R M GR RLA Sbjct: 409 TLCHYATSR-DPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCM-----GR-RLA 461 Query: 330 Q*KLQ 344 + +LQ Sbjct: 462 ELELQ 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,081,407 Number of Sequences: 219361 Number of extensions: 1094209 Number of successful extensions: 3314 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3308 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)