Clone Name | bart52c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CDC31_SCHPO (O74435) Cell division control protein 31 | 31 | 1.6 | 2 | PRTP_PRVIF (P11871) Probable processing and transport protein (I... | 30 | 3.5 | 3 | CYAA_AERHY (Q59119) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophos... | 29 | 4.5 |
---|
>CDC31_SCHPO (O74435) Cell division control protein 31| Length = 176 Score = 30.8 bits (68), Expect = 1.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 220 FDGDKDGVVTFSETYAAFRALGF 288 FD DKD + + E AA RALGF Sbjct: 46 FDSDKDNAIDYHELRAAMRALGF 68
>PRTP_PRVIF (P11871) Probable processing and transport protein (Infected cell| protein 18.5) Length = 724 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = -3 Query: 402 LVDVLDVDRIARRLIFRSGLGAKDAIDEGSAQGG-----GGVSESEGP 274 ++ +LD DR R + R G DA +G A GG GGV + +GP Sbjct: 390 MLRMLDPDRANRDALERLLEGGDDADADGGAAGGADAGDGGVGDEDGP 437
>CYAA_AERHY (Q59119) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 843 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 289 GYAASTLSATFINGVLGPQTRPENETARYSIYIENIHK 402 GY + +S + NG+L PQ+R ++I+N+H+ Sbjct: 487 GYISKLVSWAYFNGLLTPQSRVHLFNQGSDLHIDNLHQ 524 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.129 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,262,214 Number of Sequences: 219361 Number of extensions: 817716 Number of successful extensions: 2161 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2161 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)