Clone Name | bart52c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATL4J_ARATH (Q5XF85) RING-H2 finger protein ATL4J precursor | 46 | 3e-05 | 2 | ATL2D_ARATH (Q9SL78) Putative RING-H2 finger protein ATL2D precu... | 44 | 1e-04 | 3 | ATL5C_ARATH (Q5EAE9) RING-H2 finger protein ATL5C precursor | 43 | 4e-04 |
---|
>ATL4J_ARATH (Q5XF85) RING-H2 finger protein ATL4J precursor| Length = 432 Score = 46.2 bits (108), Expect = 3e-05 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = +3 Query: 243 ETPP---GAGVRVSFRPSVAIVVGIFTMIFSLTFLLLMYAKFCH 365 +TPP + +F PS+A+V G+ ++F+LTF+LL+YAK CH Sbjct: 19 QTPPPFRNGDLVANFEPSLAVVTGVLAIMFALTFVLLVYAKCCH 62
>ATL2D_ARATH (Q9SL78) Putative RING-H2 finger protein ATL2D precursor (RING-H2| finger protein ATL12) Length = 390 Score = 44.3 bits (103), Expect = 1e-04 Identities = 17/30 (56%), Positives = 27/30 (90%) Frame = +3 Query: 276 FRPSVAIVVGIFTMIFSLTFLLLMYAKFCH 365 F+PS+AI+ G+F+++F+LTF+LL+YAK H Sbjct: 37 FKPSLAIITGVFSIVFTLTFVLLVYAKCFH 66
>ATL5C_ARATH (Q5EAE9) RING-H2 finger protein ATL5C precursor| Length = 407 Score = 42.7 bits (99), Expect = 4e-04 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +3 Query: 249 PPGAGVRVSFRPSVAIVVGIFTMIFSLTFLLLMYAKFC 362 PP S P +A+V+ + T FSLTFLLL+Y K C Sbjct: 45 PPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHC 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,042,427 Number of Sequences: 219361 Number of extensions: 675133 Number of successful extensions: 1996 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1996 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)