Clone Name | bart52b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VE2_HPV36 (P50809) Regulatory protein E2 | 33 | 0.41 | 2 | PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP recepto... | 30 | 3.5 |
---|
>VE2_HPV36 (P50809) Regulatory protein E2| Length = 509 Score = 32.7 bits (73), Expect = 0.41 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 1/105 (0%) Frame = -2 Query: 432 DPASKHAAATRKVSHEKRKSMRAQAREPPGLSPRPQQKHRLASMTTTCAAVRRRS-APTP 256 D +K + + + K R R P + RPQ K R + + R RS + + Sbjct: 227 DSTTKQLTTSEQPQQTETKG-RKYGRRPSSRTRRPQAKQRRSRSRHRSSRSRSRSQSRSH 285 Query: 255 *PVATSES*TQ*SYSLARSGVTVALLRRCSAATARPKAMRLRSRA 121 P S + S SLA++GV R S +T+R R RSR+ Sbjct: 286 TPTTRSATTRSRSPSLAKTGVQRVSTRSRSRSTSRRGGRRRRSRS 330
>PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP receptor) (PGI| receptor) (Prostaglandin I2 receptor) Length = 385 Score = 29.6 bits (65), Expect = 3.5 Identities = 19/42 (45%), Positives = 22/42 (52%) Frame = +2 Query: 311 SRCFCCGRGLKPGGSRACALMLFLFSWLTFLVAAACLLAGSV 436 S CF R +PGG CA +L S + LVAA L GSV Sbjct: 168 SWCFIRMRSAEPGG---CAFLLAYASLVALLVAAIVLCNGSV 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,991,869 Number of Sequences: 219361 Number of extensions: 530249 Number of successful extensions: 2218 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2214 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)