Clone Name | bart52a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | K1279_HUMAN (Q96EK5) Protein KIAA1279 | 32 | 0.95 | 2 | GP156_HUMAN (Q8NFN8) Probable G-protein coupled receptor 156 (GA... | 31 | 1.6 | 3 | RLA0_METMA (Q8PY51) Acidic ribosomal protein P0 homolog (L10E) | 28 | 8.1 | 4 | NUOL_RICCN (Q92G97) NADH-quinone oxidoreductase chain L (EC 1.6.... | 28 | 8.1 |
---|
>K1279_HUMAN (Q96EK5) Protein KIAA1279| Length = 621 Score = 31.6 bits (70), Expect = 0.95 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 6/92 (6%) Frame = -3 Query: 261 RKPYDCSHSSAAAVAGEEELRRMAAEDRGDARMEEDG------VAGMPSEMRRP*AATAR 100 ++PY +S+ A + + L A ED + EDG G+P+E+ P A+ Sbjct: 30 KEPYKSKYSARALLEEVKALLGPAPEDEDERPEAEDGPGAGDHALGLPAEVVEPEGPVAQ 89 Query: 99 REMRKGTSGKERRCRRIAIATEEVGAGRRALV 4 R +R E I TEE+ AG LV Sbjct: 90 RAVRLAVI--EFHLGVNHIDTEELSAGEEHLV 119
>GP156_HUMAN (Q8NFN8) Probable G-protein coupled receptor 156 (GABAB-related| G-protein coupled receptor) (G-protein coupled receptor PGR28) Length = 814 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +1 Query: 259 PSVHHHRVRKHVPGAHLRLPHVQGGHVP 342 PS HR + VPGAH RL HVQ G P Sbjct: 617 PSSVGHRANRTVPGAHSRL-HVQNGDSP 643
>RLA0_METMA (Q8PY51) Acidic ribosomal protein P0 homolog (L10E)| Length = 347 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 237 SSAAAVAGEEELRRMAAEDRGDARMEEDGVAGM 139 ++ AA A EEE + E+ + EEDG+AG+ Sbjct: 310 ATVAAPAAEEEKKEEEPEEEEEDHAEEDGMAGL 342
>NUOL_RICCN (Q92G97) NADH-quinone oxidoreductase chain L (EC 1.6.99.5) (NADH| dehydrogenase I, chain L) (NDH-1, chain L) Length = 657 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +2 Query: 200 LNSSSPATAAAEECEQ-SYGFLPCTTTVFGN-MFLVLTYGFLMFKAATFLSAGS 355 ++S A C Q Y F+ C + + + +F ++T+ F FKA FLSAGS Sbjct: 306 MHSDIKKIIAYSTCSQLGYMFMACGVSAYNSGIFHLVTHAF--FKALLFLSAGS 357 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,076,018 Number of Sequences: 219361 Number of extensions: 490253 Number of successful extensions: 2141 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2137 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)